KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os10t0563000-01Help
Entry
Os10t0563000-01   CDS       T02163                                 

Gene name
Os10g0563000
Definition
Similar to Palmitoyl-protein thioesterase-like.
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:dosa01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:dosa00062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr10:join(22216517..22216628,22216750..22216834,22217985..22218036,22218132..22218152,22218239..22218292,22218775..22218825,22219020..22219082,22220032..22220097,22220204..22220242,22220928..22221050,22221570..22221662,22221769..22221954)
AA seq 314 aa AA seqDB search
MMAYALRGAALVGVLLLVVASPALVPVASAVPFIVLHGIGDQCENGGMASFTEMLGEWSG
SKGYCIEIGRGAWDSWLMPLQEQADTVCKKVKKMKELRKGYSIVGLSQGNLIGRAVIEYC
DGGPPVKNFISIGGPHAGTASVPLCGSGIVCVLIDALIKLEIYSNYVQAHLAPSGYLKIP
TDMTDYLKGCKFLPKLNNEIPSERNATYKQRFSSLENLVLIMFEDDAVLIPRETAWFGYY
PDGAFSPVQPPQKTKLYTEDWIGLKALEEAGRVKFVSVPGGHLSISRSDTKKYIVPYLKP
DGSSRFGIRRILSD
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgatggcctacgcgctgcgcggtgccgccctcgtcggcgtcctcctcctcgtcgtggcc
tccccggcgctcgtcccggtggcctccgccgtgcccttcatcgtcctgcacgggatcggc
gaccagtgcgagaacggtgggatggcgtccttcaccgaaatgcttggggaatggtccggc
tccaagggatactgcattgaaattggaagaggagcatgggactcttggctgatgccactt
caagagcaggcagacactgtttgcaagaaggtgaagaaaatgaaagaactccgtaaaggt
tacagcatagttggcctttctcaggggaacttaattggtcgggcagtaattgagtactgc
gatggtggaccaccggtaaagaatttcatctcgattggtggtcctcatgctggtacggca
tcagtaccactttgcggttctggcatcgtttgtgttcttattgatgctctgattaaattg
gagatatattcaaactatgtacaggcacaccttgctcctagtggttacctaaagataccc
actgatatgacagattatttgaagggttgcaagtttcttccaaagcttaacaatgagata
ccaagtgaaagaaatgctacgtataaacaaagattcagcagcctggaaaatctagtattg
attatgtttgaggacgacgcagtgttaataccccgggaaacggcatggttcgggtactat
cccgatggcgccttcagtccagtgcagccacctcaaaagacaaagttgtacacggaggac
tggatcggcttgaaggctttggaggaggctgggcgtgttaagttcgtatcagtgccagga
ggtcacctgagcatctccagaagtgacacgaagaagtacatagtgccatacttgaaaccg
gacggatcatccaggttcggcattcgtcgcatcttgtcggattga

DBGET integrated database retrieval system