KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os10t0564800-01Help
Entry
Os10t0564800-01   CDS       T02163                                 

Gene name
Os10g0564800, CBL1, CALCINEURIN_B-LIKE_PROTEIN_1
Definition
Similar to Calcineurin B-like protein 1.
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Protein phosphatases and associated proteins [BR:dosa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Os10t0564800-01 (Os10g0564800)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
RAP-DB: 
Oryzabase: 
Position
chr10:join(22299140..22299218,22299359..22299441,22306466..22306525,22306640..22306748,22306829..22306881,22307102..22307182,22307282..22307394,22308224..22308287)
AA seq 213 aa AA seqDB search
MGCFQSTARRPRPGYEDPVGLASETAFSVSEVEALFELFKSISGSVIDDGLINKEEFQLA
LFKNKRKENLFANRIFDLFDVKKRGVIDFGDFVRALNVFHPNIPMEEKIDFSFKLYDMDN
TGFIERKEVKQMLIALLGESEMRLSDEIIETILDKTFSDADTNQDGRIDRTEWENFVSRN
PSLLKIMTLPYLKDITTTFPSFVFNSEVDDLVT
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggggtgcttccagtcgacggcgaggcgtccgcgcccggggtacgaggaccccgtcggc
ctcgcctccgagaccgcctttagcgtaagtgaggtggaggctttgttcgagctgttcaag
agcattagtggttctgtgatcgacgatgggctcatcaataaggaagagttccaacttgca
ttgtttaaaaacaaaaggaaggaaaatcttttcgctaatcggatatttgacctttttgat
gtgaagaaaaggggggtcatcgactttggtgactttgttcgagctttaaatgtatttcat
ccaaacatcccaatggaagagaaaattgatttttccttcaagctatatgatatggacaac
actgggtttattgaacgaaaggaggtaaaacagatgttgattgctcttctaggtgaatca
gaaatgagattatctgatgagattattgagacaatccttgacaagacgttttcagatgct
gatactaatcaggatgggagaatagatagaacagagtgggagaattttgtctcaaggaat
ccctctttattgaagataatgactcttccgtacctcaaggacataacaaccacatttccc
agttttgtattcaattctgaggttgatgatctcgtcacatga

DBGET integrated database retrieval system