KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os10t0569200-01Help
Entry
Os10t0569200-01   CDS       T02163                                 

Gene name
Os10g0569200
Definition
Six-bladed beta-propeller, TolB-like domain containing protein.
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Os10t0569200-01 (Os10g0569200)
Translation factors [BR:dosa03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    Os10t0569200-01 (Os10g0569200)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr10:complement(join(22567438..22567559,22566685..22566925,22566172..22566318,22565916..22566044,22565672..22565800,22565516..22565599,22565320..22565444,22565025..22565223,22564405..22564937,22564027..22564135,22563589..22563930))
AA seq 719 aa AA seqDB search
MALEISMEGIEARARELGVDLSTVDLDSVTLPAGEDFGILSDDEDLLRIDDPMELEMGFA
NVVVVDNLPVVPPEKFEKLENVIRKIYSQIGAIKEGGLWMPVNPETKKTYGYCFIEYNTP
QEAELAREKTNGYKLDKSHIFAVNMFDDFDKYMKVPDEWMPAEIKPYTPGENLQKWLADE
KARDQFVIRAGTFTEVYWNDARQKMPELVFQKQYWTDSFIQWSPLGTYLATVHRQGSQVW
GGDDKFERLMRFAHAQVKLIDFSPGEKYLVTYSSHEPSNPRDTHRVVLNIFDVRTGKVMR
DFKGSADEFSASGNISVSGVSWPIFRWGGGKDDKYFARLGKNVISVYETETFSLLDKKSL
KVENVVDFCWSPTDPIIALFVPELGGGNQPARVSLVQIPGKEELRQKNLFSVSDCKMYWQ
NSGEYLAVQVDRYTKTKKSTYTGFELFRIKERDIPIEVLELDNKNDKIIAFAWEPKGHRF
AVIHGDGPKPDISFYSMKTSNNISRVSKLTTLKGKQANALFWSPGGRFIVFAGLKGFNGQ
LEFYNVDELETMATGEHFMATDIMWDPTGRYLASAVTSVHEMENGFQIWSFSGKQLYKVS
KDHFFQFLWRPRPPSLLTPEKEDEIAKNLRKYSKKYEQEDQDAFNQLSEQERKRRKQLQE
EWEGWVAKWKQLHEEERPYRMELRDGEASDDEEEYDTKEVEIEEEVDVQEEVPFELDQE
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atggcgctagaaatctccatggaaggcatcgaagcgcgggcgcgggagcttggggtcgac
ctctccaccgtcgatctcgactccgtcaccctccccgccggcgaggacttcggcatcctc
agtgacgatgaggatttacttcggattgatgaccctatggagcttgaaatggggtttgct
aacgttgttgtcgtggacaacctgcccgttgttccaccagagaagtttgagaagttggag
aacgtcatacgcaagatctacagtcaaattggtgcgatcaaagaaggtggtctttggatg
cctgtaaacccagagacaaagaagacatacggttactgcttcatcgagtataatacccca
caggaagctgagcttgctagggaaaagacaaatgggtacaagctcgacaagtctcacatc
tttgcagttaacatgtttgatgactttgacaagtacatgaaagttccagacgaatggatg
cctgctgaaattaagccatacactcctggagagaacttgcaaaaatggctggctgatgag
aaggcccgggaccaatttgttatccgtgctggtactttcactgaagtttactggaatgat
gcaaggcagaagatgcctgaacttgtgttccaaaagcagtactggacagacagttttatt
cagtggtcccctcttggaacatacttggcaacagtgcataggcagggctcccaggtgtgg
ggtggcgacgataagtttgagcgtctaatgcgatttgctcatgcacaggtgaaactgatt
gacttctcccctggtgagaaatatttggtcacatatagtagccacgagcccagcaaccct
agagacactcatagggttgttcttaatatctttgatgtgaggactggcaaagtgatgcgc
gactttaaaggaagtgctgatgaattcagtgccagtggaaatatcagtgtttctggtgtt
tcatggcctattttcagatggggtggtggaaaagacgataaatattttgcaaggcttggg
aagaatgttatatctgtctatgagactgaaacattctcccttcttgataagaaatctctg
aaggttgagaatgttgtcgacttctgctggtctccaactgatccaatcatagcccttttt
gtccctgagttgggtggaggaaaccagcctgcaagggtgagccttgtgcaaattcctggc
aaagaggagctgcggcagaaaaaccttttcagtgtcagtgattgcaagatgtactggcag
aacagtggagaatatcttgctgtccaggttgatagatacacaaaaaccaagaagagtact
tacactggatttgagctttttagaattaaggaaagggacatacccattgaggttcttgaa
ttggacaacaagaacgataagatcattgcctttgcatgggagcccaaaggtcaccgcttt
gctgttattcatggtgatggccctaagcctgatataagcttctactccatgaaaacatcc
aacaacatcagtcgtgtgtccaagctcaccactctcaagggcaagcaggctaatgcattg
ttctggtctcctggtggaagattcattgttttcgctggtctgaagggctttaatgggcag
ctggagttttacaatgttgatgagcttgagacgatggcaacgggtgaacatttcatggct
actgacattatgtgggatcctactggaagatatcttgcatctgcagttacctcagtccat
gaaatggagaatggtttccaaatatggtctttcagtggcaagcaactttacaaggtgtca
aaggaccacttctttcagttcctgtggcgtccgagaccaccgtcgctgctgacccctgaa
aaggaagacgagattgcgaagaacctgaggaagtacagcaagaagtacgagcaagaggat
caggatgccttcaaccagctgagcgagcaggaacgcaagaggcggaagcagcttcaggag
gaatgggaaggatgggttgccaagtggaagcagctgcacgaggaagagagaccatacagg
atggagctcagagacggggaggccagtgacgatgaggaagagtacgacaccaaggaagtt
gagattgaagaggaggtagacgtccaagaagaagttccattcgagctggatcaggagtga

DBGET integrated database retrieval system