KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os11t0104866-00Help
Entry
Os11t0104866-00   CDS       T02163                                 

Gene name
Os11g0104866
Definition
Similar to Clathrin heavy chain.
Orthology
K04646  
clathrin heavy chain
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Os11t0104866-00 (Os11g0104866)
Exosome [BR:dosa04147]
 Exosomal proteins
  Proteins found in most exosomes
   Os11t0104866-00 (Os11g0104866)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr11:join(234283..234327,234437..234641,235635..235723,235832..235910,236046..236173,236381..236479,236570..236678,236918..236997,237081..237308,237385..237450,237587..237703,238140..238337,238658..238717,238830..238916,239021..239104,239209..239271)
AA seq 578 aa AA seqDB search
MAAANAPIAMREALTLTSLGIAPQFVTFTHVTMESEKYICVRETSPQNSVVIVDMAMPAQ
PLRRPITADSALMNPNTRILALKAQIPGTTQDHLQIFNIEAKTKIKSHQMPEQVVFWKWI
TPKLLGLVTQTSVYHWSIEGDSEPAKMFDRTANLANNQIINYRCDPSEKWLVLIGIAPGA
PERPQLVKGNMQLFSVDQQRSQALEAHAASFASFKVVGNENPSTLICFASKTTNAGQITS
KLHVIELGAQPGKPGFSKKQADLFFPPDFQDDFPVAMQISQKYGLIYVITKLGLLFVYDL
ETAAAVYRNRISPDPIFLTAESSASGGFYAINRRGQVLHATVNDATIVPFVSSQLNNLEL
AVNLAKRANLPGAENLVVQRFQELFAQTKYKEAAELAAESPQGLLRTPETVAKFQSVPVQ
AGQTPPLLQYFGTLLTRGKLNAYESLELSRLVVNQNKKNLLENWLAEDKLECSEELGDLV
KVGYTPDYLFLLQTILRTDPQGAVNFALMMSQMEGGCPVDYNTITDLFLQRNMIREATAF
LLDVLKPNLPEHAFLQTKFLFELVVGFGDQLGHLPKCC
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccaacgcccccatcgccatgcgcgaggccctcacgctcaccagcctgggg
atcgcgccccagttcgtcaccttcacccacgtcaccatggagtcggagaaatacatctgc
gtccgcgagacctccccgcagaacagcgtcgtcatcgtcgacatggccatgcccgcgcag
cccctccgcaggcccatcaccgccgactccgccctcatgaaccccaacacccgcatcctc
gccctcaaagctcaaatacctgggacaacacaggatcacctgcaaatcttcaacattgag
gctaaaacaaaaattaagtcccaccagatgcctgagcaggttgtgttttggaaatggatc
accccaaagttgttgggtttggtaacacaaacatcagtttatcactggtcaattgaggga
gattctgaaccggccaagatgttcgataggacggctaatttggccaacaatcaaattatc
aactatcgatgtgatccatctgagaagtggcttgtgcttattggaattgcacctggtgct
ccagagaggccacaactggtgaagggaaatatgcaacttttttctgtggatcagcaacgt
agtcaggcacttgaagcccatgcagcatcctttgcatcatttaaggtcgtgggcaacgag
aacccttcaactctcatctgctttgcctcaaagacaactaatgctgggcagatcacttct
aagttgcatgttattgaattgggtgcccagccagggaaaccagggttttccaagaagcaa
gctgatcttttcttccccccagattttcaggatgattttcctgtggccatgcagatctct
cagaagtatggccttatctatgtaattacgaagcttggccttttatttgtatatgacttg
gaaacagctgcagcggtctatagaaatagaattagtccagatcctatattcttgacagca
gagtcttctgcaagtggtggtttttatgccatcaataggagaggacaggttttacatgcc
acagttaatgatgcaaccattgtgccttttgtcagcagtcaattaaataaccttgaacta
gctgtaaatcttgccaaaagagctaatcttcctggggcagagaacttagttgtgcaaagg
tttcaagaattgtttgcacaaacaaaatacaaggaagcagctgagttggctgcagaatct
cctcaaggtcttctccgaactcctgagactgttgcaaaatttcagagtgttcctgttcaa
gctgggcaaacgcctccactcttgcagtactttggcacattgctaactcgggggaagctc
aatgcttacgagtctcttgagctatctcgacttgttgtcaatcagaacaaaaagaacctt
ttggaaaactggttggctgaagacaaattggagtgcagtgaagaacttggagatcttgtc
aaggttggatacacccctgactacctcttcctcctccagaccattttacgtacggatcca
cagggagctgtcaactttgcgctcatgatgtcacaaatggaggggggctgtccagttgat
tacaatactataactgatctcttccttcagagaaacatgatacgtgaggcaacagctttc
ctgctggatgttttaaagccaaacttgccggagcatgcttttcttcaaaccaagtttctg
tttgaattggttgtaggttttggagatcaacttggtcacttacccaaatgttgctga

DBGET integrated database retrieval system