KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os11t0104900-00Help
Entry
Os11t0104900-00   CDS       T02163                                 

Gene name
Os11g0104900
Definition
Similar to Clathrin heavy chain.
Orthology
K04646  
clathrin heavy chain
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Os11t0104900-00 (Os11g0104900)
Exosome [BR:dosa04147]
 Exosomal proteins
  Proteins found in most exosomes
   Os11t0104900-00 (Os11g0104900)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr11:join(241107..241958,242052..242537,242625..242795,242888..243073,243424..243546,243628..243738,243832..244002)
AA seq 699 aa AA seqDB search
MTADLPHELIELLEKIVLQNSAFSGNFNLQNLLILTAIKADPSRVMDYVNRLDNFDGPAV
GEVAVEAQLFEEAFAIFKKFNLNVQAVNVLLDNIRSIERAEEFAFRVEEDAVWSQVAKAQ
LREGLVSEAIESFIRADDATHFLDVIRAAEEANVYDDLVKYLLMVRQKAREPKVDGELIF
AYAKIDRLSDIEEFILMPNVANLQNVGDRLYDEELYEAAKIIYAFISNWAKLAVTLVKLK
QFQGAVDAARKANSAKTWKEVCFACVDAEEFRLAQICGLNIIVQVDDLEEVSEYYQNRGC
FNELISLMESGLGLERAHMGIFTELGVLYARYRPEKLMEHIKLFSTRLNIPKLIRACDEQ
QHWKELTYLYIQYDEFDNAATTIMNHSPDAWDHMQFKDVAVKVANVELYYKAVHFYLQEH
PDLINDLLNVLALRLDHTRVVDIMRKAGQLHLVKPYMVAVQSNNVSAVNEALNELYVEEE
DYERLRESVDMHDNFDQIGLAQKLEKHELLEMRRIAAYIYKKAGRWKQSIALSKKDNMYK
DCMETCSQSGDRELSEDLLVYFIEQGKKECFASCLFICYDLIRADVALELAWMNNMVDFA
FPYLLQFIREYTSKVDELVKDRIESQNEVRAKEKEEKDLVAQQNMYAQLLPLALPAPPGM
GGPPPPMGMPGMPPMGGMGMPPMGPGPMPAYGMPPMGSY
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgacagctgatcttccccatgaactgattgaacttcttgaaaagatcgtccttcagaat
tctgctttcagtggaaacttcaatctgcagaaccttctcatcttgacagccatcaaggct
gacccatccagggtcatggactatgtcaacaggctggacaactttgatgggcctgctgtt
ggagaagtagcagttgaagcacagctgtttgaggaggctttcgctatcttcaagaagttc
aacttaaatgtgcaggctgtcaatgttctattggacaacatccgaagcatagaaagagct
gaagagtttgcattccgtgttgaagaagatgctgtttggagccaggttgccaaggcccag
ttgcgtgaaggtttggttagtgaagcaattgagtccttcattcgtgcagatgatgcaaca
catttcctcgacgtcatccgtgctgctgaggaagctaatgtatacgatgatctagttaag
tacttgcttatggtaaggcagaaggcaagggaacccaaagttgatggagaactcatcttt
gcgtatgctaagattgatagactcagtgatattgaagagttcattctcatgccaaatgtt
gccaatcttcaaaatgttggtgatcgtctgtatgatgaagaactttatgaagcagcaaag
atcatctatgccttcatctcaaactgggctaagctggctgttacccttgttaagctgaag
cagttccaaggtgctgtggatgctgctcgcaaggctaacagtgctaaaacatggaaggaa
gtctgctttgcttgtgttgatgccgaggagttccggctagcacaaatatgtggtctcaat
attattgtccaggttgatgatttggaggaagtaagtgaatactaccagaacagaggatgt
ttcaatgaacttatttccctcatggaaagtggtctaggactggagcgtgctcacatgggc
atcttcacagaattaggagtcctctatgctagatatcgccctgagaagctcatggaacac
atcaaacttttctccacacgtctcaacattcctaagcttatccgtgcttgtgatgaacag
cagcactggaaagagcttacttacctatacatccagtatgatgaatttgacaatgctgcc
accactattatgaaccattctccggatgcatgggatcatatgcaatttaaggatgttgct
gttaaagttgcaaatgttgagctatactacaaggcagtgcacttctatctgcaagagcat
cctgatctcatcaatgaccttctcaatgtacttgcgcttcgtttggatcatacaagagtc
gtggacataatgcgcaaggctggtcagttgcatcttgtgaaaccatacatggttgcagtt
cagagcaacaatgtctctgctgtgaatgaagctttgaatgagctttatgttgaagaggag
gactatgagagactccgtgaatcggttgatatgcatgacaactttgatcagataggtctt
gcccaaaagcttgagaagcatgaattgcttgagatgaggaggatcgctgcctacatttac
aagaaggctggcagatggaagcaatctattgccctgtcgaagaaagacaacatgtacaag
gattgcatggagacatgctcacagtctggtgaccgcgagctgtcagaagatttgcttgtc
tatttcattgaacagggaaagaaagaatgctttgcttcttgtctctttatttgttatgac
ttgatccgtgcggatgttgctcttgagcttgcatggatgaacaacatggtggactttgca
ttcccctatctgttacagttcattcgggagtacacaagcaaggttgatgagctagtgaag
gacaggattgaatcacagaatgaagtaagggctaaagagaaggaagaaaaagatcttgtt
gctcagcagaacatgtatgcccaattgcttcctctcgccttgcctgctccacctggtatg
ggcggtcctccaccgccaatggggatgccgggcatgcctccgatgggcggaatggggatg
cctccgatgggtcccggacctatgccagcatatgggatgcctccaatgggaagctactga

DBGET integrated database retrieval system