KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os11t0146600-00Help
Entry
Os11t0146600-00   CDS       T02163                                 

Gene name
Os11g0146600
Definition
Similar to Lipase family protein.
Orthology
K16818  
phospholipase A1 [EC:3.1.1.32]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glycerophospholipid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Os11t0146600-00 (Os11g0146600)
   00592 alpha-Linolenic acid metabolism
    Os11t0146600-00 (Os11g0146600)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.32  phospholipase A1
     Os11t0146600-00 (Os11g0146600)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr11:2110687..2111904
AA seq 405 aa AA seqDB search
MAASISGARTCYPSAAVARRGGGGGRCCSVVRSSLATSSPATCKPSGMMRIGRQWTELQG
ARDWDGLLNPLDGALRGELVRYGEFVRAAYASFDFDGGAPSSYGSCRFPTSSLLRRSGLP
ETGYRVTGILHAASTSAPGWLSCRSSYIGYVAVCDDEDEIERLGRRDVVIAFRGTATCGE
WVDNFKSTLTHLPPRSGDGEAAPPMVESGFWRLFTTPGEAHGSLQQQVRGEVQRIVSEYG
GEGMPPLSITVTGHSLGAALAVLTAYDITTNSPMQRHGGGDDDDGEAPMVTAVSFGGPRV
GNAAFRRRLEESGGKVLRVVNSNDVVTKVPGFPVDGDDCGGGAREGDAPARRKPRLPRWL
VSKMGWEYSDVGRELRLCSQGDTARNVVASHDLDLYLKLVAACTY
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcggcttctatctccggagctcgcacttgctaccctagcgcggcggtggcgcgacgt
ggcggcggcggcggccggtgctgctccgtcgtcaggagctcgctggcgacctcgtcgccg
gcgacgtgcaagccgtcagggatgatgcggattggcaggcagtggacggagctccagggt
gctcgtgattgggacggcctgcttaacccgctcgacggcgcgctccggggcgagctcgtc
cgctacggcgagttcgtccgcgccgcgtacgccagcttcgacttcgacggcggcgcgccg
tcgtcgtatgggtcgtgccggtttccgaccagctccctgctgcgccgctccgggctccct
gagactggctaccgggtcaccgggatcctccacgccgcgtcgacgtcggcgccgggctgg
ctgtcgtgcaggtccagctacattgggtacgtcgcggtgtgcgacgacgaggacgagatc
gagcggctgggtcgccgcgacgtcgtcattgcgttccgcggcacggcgacgtgcggcgag
tgggtggacaacttcaagtccactctcacccacctgccgccgcgatccggcgacggcgag
gcggcgccgccgatggtggagagtggattctggaggctcttcaccaccccgggcgaagcg
cacggcagcctgcagcaacaagtgcgcggcgaggtgcagcggatcgtcagcgagtacggc
ggcgagggcatgccgccgttgagcatcacggtcaccggacacagcctcggcgccgcgctc
gcggtgctcaccgcctacgacatcacgacaaactcccccatgcaacgccacggcggcggc
gacgacgacgacggcgaggcgccgatggtgaccgccgtgtcgttcggcgggccgcgcgtg
ggcaacgcggcgttccggcgaaggctggaggagagcggcggcaaggtgctccgcgtggtg
aactcgaacgacgtcgtgaccaaggtgccggggttccccgtcgacggcgacgactgcggc
ggcggcgctcgggagggcgacgcgccggcgaggaggaaaccgaggttgccgaggtggctg
gtgtccaagatggggtgggagtacagcgacgtcggccgcgagctgcgcctttgcagccag
ggcgacacggcgcgcaacgtggttgcatcgcatgaccttgatttgtatctcaagctcgtg
gcagcctgcacatattag

DBGET integrated database retrieval system