KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os11t0184100-01Help
Entry
Os11t0184100-01   CDS       T02163                                 

Gene name
Os11g0184100
Definition
3-oxo-5-alpha-steroid 4-dehydrogenase, C-terminal domain containing protein.
Orthology
K09591  
steroid 5-alpha-reductase [EC:1.3.1.22]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Brassinosteroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00905 Brassinosteroid biosynthesis
    Os11t0184100-01 (Os11g0184100)
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     Os11t0184100-01 (Os11g0184100)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr11:4253866..4254684
AA seq 272 aa AA seqDB search
MTDRQAMAMGSSDGDVLYARCLVTLYLLSPLNVFALWFMSAPYGKLSRPGWGPTVPAALA
WCLMESPTLWLPPLVLSATTTSLSTPTLRVTILPAALYMLHYVHRTLVHPLRLLRLRRAP
APMPILIIMFGFSFNLLNAYIQARSWALDAVPPATATPLTVARCLVGLALFVWGMWTNIA
ADRELLRLKEAGKGYQIPKDGLFDLVACPNYFGETVEWLGYALVAWTPAAWAFFLYTCVN
LGPRARDQRLWYISKFGDKYPASRKAFIPYIY
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgactgaccggcaagccatggctatgggcagcagcgacggtgacgtgctgtatgcccga
tgcctggtcacactgtacctgctcagcccgctcaatgtgttcgcgctctggttcatgtcg
gcaccgtacgggaagctgtcccgcccggggtggggtcccacggtgccggcagcactcgcc
tggtgcctcatggagagccccaccctctggctcccaccccttgtcctctccgccaccacc
acctccttgtcaaccccgacgctgcgcgtcaccatcctcccggcggcgctgtacatgctc
cactacgtgcaccgcacgctcgtccacccactccggcttctccgcttgcgccgtgccccg
gcgcccatgccgatcctcatcatcatgtttggcttcagcttcaacctcctcaacgcctac
atccaggcacgttcttgggcgctcgatgctgtgcctccagccaccgccacgccactcact
gttgcccgctgtctcgttgggctggccctcttcgtgtgggggatgtggaccaacattgca
gcagacagggagctgctgaggctcaaggaggctggcaaagggtaccagattcccaaggac
gggctgttcgatttggtcgcctgccccaactacttcggcgagaccgtggagtggcttggc
tatgccctggtagcatggacgcctgcggcctgggccttcttcctctacacctgcgtcaac
ctcggaccgagggcgagagaccagcgcctgtggtacatcagcaagttcggagacaagtac
ccggcgtcgcgcaaggcgttcatcccgtacatctactaa

DBGET integrated database retrieval system