KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os11t0199200-01Help
Entry
Os11t0199200-01   CDS       T02163                                 

Gene name
Os11g0199200
Definition
Similar to Protein disulfide isomerase (Fragment).
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Os11t0199200-01 (Os11g0199200)
Enzymes [BR:dosa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Os11t0199200-01 (Os11g0199200)
Exosome [BR:dosa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Os11t0199200-01 (Os11g0199200)
  Exosomal proteins of colorectal cancer cells
   Os11t0199200-01 (Os11g0199200)
  Exosomal proteins of bladder cancer cells
   Os11t0199200-01 (Os11g0199200)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr11:complement(join(4974797..4974999,4974127..4974157,4973734..4974021,4973442..4973630,4973175..4973300,4972747..4972884,4972545..4972664,4972317..4972434,4972014..4972126,4971689..4971901))
AA seq 512 aa AA seqDB search
MAISKAWISLLLALAVVLSAPAARAEEAAAAEEGGDAAAEAVLTLDADGFDEAVAKHPFM
VVEFYAPWCGHCKKLAPEYEKAAQELSKHDPPIVLAKVDANDEKNKPLATKYEIQGFPTL
KIFRNQGKNIQEYKGPREAEGIVEYLKKQVGPASKEIKSPEDATNLIDDKKIYIVGIFSE
LSGTEYTNFIEVAEKLRSDYDFGHTLHANHLPRGDAAVERPLVRLFKPFDELVVDSKDFD
VTALEKFIDASSTPKVVTFDKNPDNHPYLLKFFQSSAAKAMLFLNFSTGPFESFKSVYYG
AAEEFKDKEIKFLIGDIEASQGAFQYFGLREDQVPLIIIQDGESKKFLKAHVEPDQIVSW
LKEYFDGKLSPFRKSEPIPEVNDEPVKVVVADNVHDFVFKSGKNVLVEFYAPWCGHCKKL
APILDEAATTLKSDKDVVIAKMDATANDVPSEFDVQGYPTLYFVTPSGKMVPYESGRTAD
EIVDFIKKNKETAGQAKEKAESAPAEPLKDEL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggcgatctcgaaggcttggatctcgctgctgctcgcgctcgccgtggtgctgtcggcg
ccggcggcgagggcggaggaggcggcggctgcggaggaggggggcgatgcggcggcggag
gccgtgctgacgcttgacgcggacggcttcgatgaggccgtcgccaagcacccgttcatg
gtcgtcgagttctacgccccgtggtgtggacactgcaagaagctcgctccagagtatgag
aaagctgcacaagagctaagcaagcacgatccaccgattgttcttgccaaggttgatgcc
aacgacgagaagaacaagcctcttgctaccaagtatgagatccagggtttcccgacactc
aagatattcaggaaccagggcaagaacattcaggaatacaagggcccgagggaggctgag
ggcattgttgaatacttgaagaagcaggttggtcctgcttccaaggagatcaagtcacca
gaagacgcaaccaaccttattgatgacaagaaaatctacattgttggaatcttctcagaa
ttaagtggcactgagtatacaaacttcatagaggttgctgagaagctgagatctgattat
gactttggccacaccttgcatgccaaccaccttccacgcggtgatgctgcagttgagaga
ccattggttaggctattcaagccctttgatgagcttgttgttgacagcaaggattttgat
gttactgctttggagaagttcattgatgctagcagcacccctaaagttgttacttttgac
aagaaccctgacaaccatccttaccttctgaaatttttccaaagctcagctgccaaggct
atgctatttttgaacttctccactggaccgtttgagtctttcaagtcagtttattatggt
gctgctgaggagttcaaggacaaggaaattaagttcctcattggtgacattgaggccagt
caaggtgccttccagtactttgggctgagggaggatcaggtaccactcatcatcatccag
gatggtgagtccaagaaatttttgaaggcacacgttgagcctgaccaaattgtttcttgg
ttgaaggaatactttgatggtaaattgtctccattcaggaagtctgaacctattcctgag
gtcaacgacgagcctgttaaggttgtggtcgctgataacgtccatgattttgtcttcaag
tctggcaaaaacgtccttgttgaattctatgcaccatggtgcggacactgcaagaagctg
gctccaatcttggatgaggcagctacgacgcttaaaagcgacaaggatgttgtcatcgct
aagatggatgcaactgcgaacgatgtgccaagcgagttcgatgtgcaaggttaccccacc
ctgtacttcgtcacccccagtggaaagatggttccctatgaaagcggcaggacagccgac
gagatcgtcgacttcattaagaagaacaaggaaaccgctggtcaggcgaaggagaaggca
gagtcggccccagccgagcctctcaaggatgagctctaa

DBGET integrated database retrieval system