KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os11t0242100-01Help
Entry
Os11t0242100-01   CDS       T02163                                 

Gene name
Os11g0242100
Definition
Beta-glucosidase, GBA2 type domain containing protein.
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:dosa00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:dosa00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr11:join(7597191..7597268,7597632..7597736,7598014..7598070,7598191..7598261,7598767..7598866,7599803..7599873,7600006..7600106,7600188..7600291,7600405..7600458,7600594..7600649,7600745..7600783,7600899..7601043,7601916..7602097,7602187..7602254,7603606..7603678,7603768..7603829,7603913..7604837,7605601..7605891,7606359..7606629)
AA seq 950 aa AA seqDB search
MVENGVLEQPKGVSRNRPRAQSNDHPVDPGYLPELTWEHKLSNIGYDLPSFRLTWRETFQ
LAGLGLRLGRHILEETSKGRAAVIDPMKKRIAKSGQGVPLGGIGSGSIGRSYKGEFQRWQ
LFPGTCEERPVLANQFSAFISRKDGRNYSSVLHPGKPDLPKGSNISGIGSWDWNMSGQNS
TYHALYPRSWTIYNGEPDPDVNIVCRQISPIIPHNYQQSSYPVSVFTFTVTNSGNTAADV
TLLFTWANSVGGKSELTGYHSNSPMIEKDGVHGILLHHRTANGQPPVTFAIAAQEKEDIH
ISECPYFIISGSSDAFSAKDMWNYVKENGSFDNLDLTKTSMCSKPGLSIGAAIAASVKLP
PQTTQNVSFALAWACPEVKFSSGKTYHRRYTKFHGTDNDAAASLAHDAILEHNSWERQIE
EWQNPILQDERFPDWYPVTLFNELYYLNAGGTIWTDGLPPIQSLTGIGEKKFSLDMQNGD
ADDANGIIPRNNTASDILNQMASVLERIHASMESNSAIGTTLLQGEENIGQFLYLEGIEY
YMWNTYDVHFYASFSLIMLFPKLQLSIQRDFAAAVLMHDPEKLRMLHDGKWVARKVLGAV
PHDLGLYDPWFKVNAYTLYNTDRWKDLNPKFVLQVYRDVVATGDKSFARAVWPSVYMAMA
YMEQFDRDKDGMIENEDFPDQTYDVWSMAGISAYCGGLWVAALQAASALAHEVGDKASEK
LFWDKYEKAKSVYGKLWNGSYFNYDDGDNIMSASIHADQLAGQWYAKACGLFPIVDKDKA
ESALEKIYSFNVMKFKDGKRGAMNGMWPDGTVDMSAMQSREIWPGVTYALAATMIQEGMV
EKGFKTAEGIYHAAWSPEGLGYSFQTPEAWNNDDEYRSLCYMRPLAIWAIQWALSNPKLH
KQTADIPQDSFPKNQFSYARIAKLLHLPEDESPKSFLRVIYEIVRNRYRS
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
atggtagagaatggtgttctggagcaaccaaagggggtgtctcgaaataggccacgtgct
cagtcgaatgatcatccagttgatcctggatacctcccagagttgacatgggaacacaag
cttagcaatattggctatgatttgccatccttcagacttacatggagagagacattccag
ttggctggccttggtcttcgtcttggccgacacatccttgaagaaacatcaaaaggacgt
gctgctgtgattgatcccatgaagaagcgcattgcaaaatctggtcagggtgttccactt
ggcggcattggttcaggaagtattggaaggagctacaaaggcgagtttcaacgctggcaa
ttgttcccgggaacttgtgaagagagacctgtactggcaaatcaattttctgcgttcatt
tcccgcaaagatggtagaaactattcctcagtgctgcatcctgggaaaccagatttgcca
aaaggaagtaacatttcaggaattggatcctgggactggaatatgagtggacaaaactct
acgtaccacgctctttaccctaggtcctggacgatatacaatggagaacctgacccagat
gtcaacatagtgtgtcgtcagatttctccaattattccacataattatcaacagagcagc
tatccagtttctgtattcactttcacagtaactaactcaggcaatacggctgctgatgta
actttgctttttacatgggctaactctgttggtgggaaatctgaactaactggatatcac
tccaattcccctatgatagaaaaggatggtgtgcatggcattctgttacatcacagaaca
gctaatggacaaccaccagttacttttgccatagctgcacaagagaaagaagatattcat
atctcggaatgcccttactttataatatctggaagttctgatgcattttcagcaaaagac
atgtggaattatgtgaaagagaatggatcttttgataaccttgatctcaccaaaacatcg
atgtgctcaaaacctggattatcaataggggcagctattgcagcttctgttaagctgcct
ccccagacaacccagaatgtatcatttgcacttgcctgggcttgtcctgaagtgaaattc
tccagtggaaaaacctaccataggcgttatacgaaatttcatggcacggataatgatgca
gcagcaagccttgctcatgatgccattctagaacataattcttgggaaaggcaaattgag
gagtggcagaatcctattttgcaagatgagaggtttcctgactggtacccggtcacactt
ttcaatgagttatactaccttaatgctggaggaactatatggactgatggattgccacca
attcaaagcttgacaggtattggtgaaaagaagttttctctggacatgcaaaatggggac
gctgatgatgccaatgggataatcccacggaataatactgccagcgacatccttaatcaa
atggcatcagtactcgagagaattcatgcatctatggaatcaaattctgccataggaaca
actttacttcagggtgaagagaatattggccaattcctctaccttgagggcattgagtat
tatatgtggaacacatatgatgttcatttctatgcatcattctctctgatcatgctgttt
ccaaaactccagctcagcattcagagagatttcgctgctgctgttttgatgcatgatcct
gaaaagctcaggatgttacatgatggaaaatgggttgcgagaaaagttcttggtgctgtt
cctcatgatcttgggctatatgacccctggttcaaagttaatgcatatacgctctataac
acagatcgatggaaggacttgaacccaaagtttgttctgcaagtttatagagatgtggtt
gccacaggtgacaaatcctttgctcgtgctgtttggccatctgtttatatggcaatggca
tatatggagcaatttgacagggataaagatgggatgattgaaaatgaggactttccagat
cagacttatgatgtgtggtcaatggctggtataagtgcgtactgtggtggactttgggtg
gccgctcttcaagctgcgtcagccttggcacacgaagttggtgacaaagcgtctgaaaaa
cttttctgggacaagtatgagaaggctaagtctgtttatggcaagttgtggaatggttct
tacttcaattatgatgatggcgacaacataatgagtgcatccatccatgcggatcaattg
gctggacaatggtatgccaaagcttgcggtctcttcccaattgttgacaaggataaggcg
gaaagtgcactagaaaagatatattctttcaatgtgatgaaattcaaggatggtaaaagg
ggagcaatgaatgggatgtggccagatggcacagtggacatgtccgcaatgcaatctcgg
gagatatggccaggtgtgacatatgcacttgctgcaaccatgattcaagaaggcatggtt
gagaaggggttcaaaacagctgaggggatttatcatgctgcctggtctccagaaggactt
gggtactcatttcaaacccctgaagcttggaacaatgacgatgaataccgatcgttgtgc
tacatgcgccctcttgcaatatgggccatacagtgggcactatcaaacccaaaactccac
aagcagactgcagatatcccacaggactctttcccaaagaaccagttctcgtatgctcgg
attgcgaagttgctgcatttacctgaagacgaatcgccgaagagtttccttcgagtgatt
tatgagattgttcgtaacaggtataggtcctga

DBGET integrated database retrieval system