KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os11t0473200-01Help
Entry
Os11t0473200-01   CDS       T02163                                 

Gene name
Os11g0473200
Definition
Similar to Ubiquitin carboxyl-terminal hydrolase 12 (EC 3.1.2.15) (Ubiquitin thiolesterase 12) (Ubiquitin-specific processing protease 12) (Deubiquitinating enzyme 12).
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr11:join(16317121..16317263,16318451..16318693,16319484..16319628,16319850..16319909,16319992..16320087,16320267..16320728)
AA seq 382 aa AA seqDB search
MEMEMEMVVAVPSPEVPAEEERALIRDITVAAEAHAKEGDTFFLITHRWWQSWIDYVIQD
LANSTNNGSHHHEHGSNVLRRPGAIDNTDLIDDTASEVSNMEIELHDTLVEGRDYILLPQ
QVWEKLHGWYGGGPTLPRKAINTGLSQTDLAIEVYPLRLQLLLAPKGEQAVIRISKKDTV
GELHKKACEVFDLIPDEVCIWDYYGRTRHSLMDNLEKTLDDANIQMDQDILVEVTTDANG
SLDGGCIGSIQENEYLERESTSLIADASKSGLSNENFASNNYTSRSYSSSLTQSQYLRSS
NGDLDNMHGTSAMITRGSPLGLTGLLNLGNTCFMNSAIQCLVHTPEFARYFREDYHREIN
WQNPLGMVVSTLSTSMALKPYV
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggagatggagatggagatggtggtggccgtgccgtcgccggaggtgcccgcggaggag
gagagggcgctgatccgggacatcaccgtcgccgccgaggcccacgccaaggaaggggac
accttcttcctcatcacccacaggtggtggcaaagttggattgattatgtcattcaagat
ttggctaattcaacgaataatggttctcatcatcatgagcatggttctaacgttctgaga
agaccaggagcaattgacaatacagatttgatagatgatactgcatctgaagtctcgaat
atggagattgaactacatgatacattggttgagggtcgtgactatatactgcttccccaa
caagtctgggaaaagttgcacggttggtatggtggaggaccaacattgccaagaaaggca
atcaatactggcttgtctcaaactgatttagccatagaagtttatcctttacgtctgcag
ttacttctggctccaaaaggagagcaagctgttataaggataagcaaaaaagatacagtt
ggcgaactccataagaaggcttgtgaggtttttgatttgatacctgatgaggtctgcatt
tgggactactatggccgaacaagacattctttgatggataacttggagaaaacccttgat
gatgccaacattcaaatggatcaagatattctagtggaggttactaccgatgcaaatggt
agtttggatggtggttgcattggttcaatccaagaaaatgaatatttagaacgagaatca
acttccttgattgcagatgcttcgaaatcaggattatcaaatgagaattttgcatcaaac
aattatacttccagaagctacagctctagtcttacacaaagccagtacctgcgatcttcg
aatggggacttagataacatgcatggtactagtgccatgatcaccagaggatctccttta
ggtcttacagggctactcaacttgggaaatacatgtttcatgaatagtgctatacaatgc
cttgtgcacacaccagaattcgctagatattttcgtgaagattaccaccgtgaaataaat
tggcaaaatcccctgggtatggtggtaagtactctttctactagcatggcgttgaagcct
tacgtttga

DBGET integrated database retrieval system