KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os11t0484400-01Help
Entry
Os11t0484400-01   CDS       T02163                                 

Gene name
Os11g0484400
Definition
Similar to bifunctional dihydrofolate reductase-thymidylate synthase.
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Os11t0484400-01 (Os11g0484400)
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Os11t0484400-01 (Os11g0484400)
   00670 One carbon pool by folate
    Os11t0484400-01 (Os11g0484400)
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Os11t0484400-01 (Os11g0484400)
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     Os11t0484400-01 (Os11g0484400)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr11:join(17055815..17056224,17056328..17056727,17056834..17056878,17057656..17057721,17058344..17058405,17058504..17058578,17058673..17058838,17059066..17059189,17060192..17060298,17060447..17060557)
AA seq 521 aa AA seqDB search
MATTLSNGVSQNGPQRNYQVVVAATRDMGIGKDGVLPWKLLGDLKFFKELTVTTADPVKK
NAVIMGRKTWESLPLKARPLPGRLNIILTRSGSFEFATVENVVICGSMNSALELLSSTPY
CLSIEKVFVIGGGQVLRESLNGPSCEAVHLTDIQSSIECDTFIPPIDLSVFQPWYSSLPV
VESNIRHSFVTYVRVRKTMAETHDSNGKESANDGIKSDKFETENFSFLPKLIFDRHEEYH
YLNLVEDIIRSGAQKNDRTGTGTLSKFGCQMRFNLRNSFPLLTTKKVFWRGVVEELLWFI
SGSTSAKVLQEKGIHIWDGNASREYLDSVGLAHREEGDLGPVYGFQWRHFGAEYTDMHAD
YTGKGFDQLMDVIDKIKNNPDDRRIILSAWNPSDLKKMALPPCHMFAQFYVESGELSCQM
YQRSADMGLGVPFNIASYSLLTYMIAHVCGLSPGEFVHVIGDAHVYRTHVRALEEQIQKL
PKPFPVLKINPLKKDIDSFVASDFKLVGYDPHQKIEMKMAI
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggctacaactctctccaatggtgtttcacagaatggccctcagaggaactatcaggta
gttgttgctgctactcgcgacatgggcattggaaaggatggggtcttgccatggaagctc
cttggcgaccttaaatttttcaaggagcttacagtgactacagctgatcctgtgaagaaa
aatgctgttataatggggaggaaaacatgggagagtttaccccttaaggctaggccattg
cctggccgtttgaacatcatattgactaggtctggtagttttgagtttgcaacagtcgaa
aatgttgttatctgtggaagcatgaactctgcattggaactactatcatcaactccatac
tgtttatccattgagaaagtttttgttatagggggtggacaagtactaagggaatctctt
aatggaccttcatgtgaggcagtccatttaactgacattcagtcaagcattgagtgtgac
acctttattcctccgattgacttatcggtgttccaaccatggtattcatctttgcctgtg
gtagagagcaacattaggcattcgtttgtgacctatgttcgggttagaaaaacaatggca
gaaacacatgactcaaatggcaaggaatcagctaatgatggtatcaagagtgacaaattt
gaaaccgagaatttctcttttctccctaagttgatatttgaccgccatgaggagtatcac
tatctcaatcttgttgaagatattataaggagtggtgctcagaaaaatgacagaacagga
acagggacattatcgaaatttggttgtcagatgcggttcaacttaaggaatagcttccca
ttgttgacaacaaagaaggtattttggaggggtgttgttgaagaactcctgtggttcatc
agtggctcgacaagtgcaaaggttttacaagagaaaggcattcatatttgggatggcaat
gcttcgagagagtatcttgacagtgttggcttagcacatagggaagaaggtgatctaggt
ccagtttatggatttcaatggcgacactttggtgctgaatataccgacatgcatgctgac
tatactggtaaaggctttgatcagctaatggatgtgattgacaagatcaagaataatcct
gacgataggcgaattatcctatctgcgtggaatccttcagatctcaagaagatggccctt
cctccttgccacatgtttgcacaattttatgttgagagcggggagctatcgtgccagatg
tatcaacgctctgctgatatgggacttggtgttccattcaacattgcatcatattctctt
ctgacatacatgattgctcatgtttgcggtctttctcctggagagtttgtccatgttatt
ggtgatgcccatgtctatagaacacatgtgcgagctctggaggagcaaatccagaagcta
cctaaaccatttccagttttgaagattaaccctttgaagaaggatatagattctttcgtg
gcatcagacttcaagctggtcggttatgatcctcaccagaagattgaaatgaaaatggca
atataa

DBGET integrated database retrieval system