KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os11t0530600-01Help
Entry
Os11t0530600-01   CDS       T02163                                 

Gene name
Os11g0530600, CHALCONE_SYNTHASE, CHS
Definition
Similar to Chalcone synthase C2 (EC 2.3.1.74) (Naringenin-chalcone synthase C2).
Orthology
K00660  
chalcone synthase [EC:2.3.1.74]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Circadian rhythm - plant
Module
Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    Os11t0530600-01 (Os11g0530600)
 Organismal Systems
  Environmental adaptation
   04712 Circadian rhythm - plant
    Os11t0530600-01 (Os11g0530600)
Enzymes [BR:dosa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.74  naringenin-chalcone synthase
     Os11t0530600-01 (Os11g0530600)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
RAP-DB: 
Oryzabase: 
Position
chr11:complement(join(19280651..19280837,19277986..19278995))
AA seq 398 aa AA seqDB search
MAAAVTVEEVRRAQRAEGPATVLAIGTATPANCVYQADYPDYYFRITKSEHMVELKEKFK
RMCDKSQIRKRYMHLTEEILQENPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKEW
GQPRSRITHLVFCTTSGVDMPGADYQLAKMLGLRPNVNRLMMYQQGCFAGGTVLRVAKDL
AENNRGARVLAVCSEITAVTFRGPSESHLDSMVGQALFGDGAAAVIVGSDPDEAVERPLF
QMVSASQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIERALGDAFTPLGISDWNS
IFWVAHPGGPAILDQVEAKVGLDKERMRATRHVLSEYGNMSSACVLFILDEMRKRSAEDG
HATTGEGMDWGVLFGFGPGLTVETVVLHSVPITAGAAA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggtgacggtggaggaggtgaggagggcgcagagggcggaggggccggcg
acggtgctggcgatcgggacggcgacgccggcgaactgcgtgtaccaggccgactacccg
gactactacttcaggatcaccaagagcgagcacatggtcgagctcaaggagaagttcaag
aggatgtgtgacaagtcgcagatcaggaagaggtacatgcacctgacggaggagatcctg
caggagaaccccaacatgtgcgcgtacatggcgccgtcgctggacgcgcggcaggacatc
gtcgtcgtcgaggtccccaagctggggaaggcggcggcgcagaaggcgatcaaggagtgg
gggcagccgcgctcccgcatcacccacctcgtcttctgcaccacctccggcgtcgacatg
cccggcgccgactaccagctcgccaagatgctcggcctgaggcccaacgtgaaccgcctc
atgatgtaccagcaggggtgcttcgccggcggcacggtgctccgcgtcgccaaggacctc
gccgagaacaaccgcggcgcgcgcgtcctcgccgtgtgctccgagatcacggcggtgacg
ttccgggggccctccgagtcccacctcgactccatggtcgggcaggcgctgttcggcgac
ggcgcggcggcggtgatcgtcggctccgaccccgacgaggccgtcgagcggccgctgttc
cagatggtgtcggcgagccagaccatcctcccggacagcgagggcgccatcgacggccac
ctgagggaggtcgggctgacgttccacctgctcaaggacgtgccggggctcatctcgaag
aacatcgagcgcgcgctgggcgacgcgttcacaccgctggggatctcggactggaactcc
atcttctgggtggcgcaccccggaggtccggcgatcctggaccaggtggaggcgaaggtt
gggctggacaaggagaggatgagggcgacgcgccacgtgctgtccgagtacggcaacatg
tcgagcgcctgcgtgctcttcatcctcgacgagatgcgcaagcgctccgccgaggacggc
cacgccaccaccggcgagggcatggactggggcgtcctcttcggcttcggccccggcctc
accgttgagaccgtcgtcctccacagcgtccccatcaccgccggcgccgccgcctga

DBGET integrated database retrieval system