KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os11t0573000-01Help
Entry
Os11t0573000-01   CDS       T02163                                 

Gene name
Os11g0573000
Definition
(RAP-DB) Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2 family protein.
  KO
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Os11t0573000-01 (Os11g0573000)
Peptidases [BR:dosa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Os11t0573000-01 (Os11g0573000)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr11:complement(join(21514181..21514324,21513880..21514098,21513702..21513810,21513496..21513611,21513167..21513265,21511143..21511252,21510492..21510566,21510413..21510413))
AA seq 290 aa AA seqDB search
EVAVRKMVDYWTYDSKKETGYVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTTENDM
PSGSIPLALQSLFYKLQYSDNSVATKELTKSFGWDTYDSFMQHDVQELNRVLCEKLEDKM
KRTVVEGTIEKLFEGHHINYIECINVDYKSNRKESFYDLQLDVKGCRDVYASFDKYVEVE
RLEGDNKYHAENHGLQDAKKGVLFLDFPPVLQLQLKRFEYDYMRDTMVKINDRYEFPLQL
DLDRDDGKYLAPDADRSIRNLYALHSVLVHSGGVHGGHYYAFIRPTLSDQ
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gaggttgctgtccgcaaaatggttgattattggacatatgattcaaaaaaagaaacaggt
tacgttggcctgaagaaccaaggagctacctgttacatgaactctctactacagacacta
taccatataccatacttcaggaaggctgtgtatcatatgccaaccaccgaaaatgatatg
ccatctgggagtattccgttggcattgcagagccttttctacaagctccagtatagtgac
aatagtgtagccaccaaagagctgaccaaatcttttggatgggacacatatgattccttc
atgcaacatgatgtacaagagctcaacagagttctctgtgagaaacttgaagataagatg
aagagaactgtcgtagagggaacgattgaaaagttattcgaaggtcaccacatcaattat
atagagtgtataaatgttgactataaatccaacaggaaggagtccttttatgaccttcaa
cttgatgttaaaggttgtcgtgatgtgtatgcatcgtttgataaatatgttgaagttgag
cgcctcgaaggtgataataagtatcatgcagagaatcatggtttacaggatgcgaaaaag
ggtgttctgttccttgatttccccccagttttgcaacttcaactgaagcgttttgagtac
gactatatgagagataccatggttaagattaatgaccgctatgaattccctttgcaactt
gatttggatagagatgatggaaaatatcttgctccagatgcagatagaagtataagaaac
ctttatgctcttcacagtgttcttgttcatagtggaggagtacatggcggtcactactat
gccttcattcgaccaacgctatcagatcaatga

DBGET integrated database retrieval system