KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os11t0602200-01Help
Entry
Os11t0602200-01   CDS       T02163                                 

Gene name
Os11g0602200
Definition
Similar to SET domain protein SDG111.
Orthology
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Os11t0602200-01 (Os11g0602200)
Enzymes [BR:dosa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Os11t0602200-01 (Os11g0602200)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr11:23160532..23162973
AA seq 813 aa AA seqDB search
MAGTRQTTSVPMDNAAVVDAKPLRTLTPMFPAALGLHTFTAKENSSSIVCITPFGPYAGG
TEQAMPASIPPMFASPAAPADPNQRQPYAVHLNGAAPANGTANNTGVIPDLQIAVAGTVE
SAKRKRGRPKRVQDSSVPSAHLVPSAPGGNITAVQTPPSATTDESGKKKRGRPKRVQDVP
VLSTPSAPQVDSTVFQTPASAVNESVTRKRGRPRRVQDGADTSAPPIQSKYNEPVLQTPS
AVTLPEDGKRKRGRPKRVPDGALIPLSHSGVSIDDDSGEIITGKRGRPRKIDVNLLNLPS
LFSDDPRESVDNVLMMFDALRRRLMQLDEVKQGAKQQHNLKAGSIMMSAELRANKNKRIG
EVPGVEVGDMFYFRIEMCLVGLNSQSMSGIDYMSAKFGNEEDPVAISIVSAGVYENTEDD
PDVLVYTGQGMSGKDDQKLERGNLALERSLHRGNQIRVVRSVRDLTCPTGKIYIYDGLYK
IREAWVEKGKTGFNVFKHKLLREPGQPDGIAVWKKTEKWRENPSSRDHVILRDISYGAES
KPVCLVNEVDDEKGPSHFNYTTKLNYRNSLSSMRKMQGCNCASVCLPGDNNCSCTHRNAG
DLPYSASGILVSRMPMLYECNDSCTCSHNCRNRVVQKGSQIHFEVFKTGDRGWGLRSWDP
IRAGTFICEYAGEVIDRNSIIGEDDYIFETPSSEQNLRWNYAPELLGEPSLSDSSETPKQ
LPIIISAKRTGNIARFMNHSCSPNVFWQPVLYDHGDEGYPHIAFFAIKHIPPMTELTYDY
GQSQGNVQLGINSGCRKSKNCLCWSRKCRGSFG
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atggctggaactcggcagacaacttcagttccgatggataatgcagcagttgttgatgca
aaacccttgcgcacattgactcccatgttccctgcggcacttggtctgcacactttcact
gctaaagaaaactcatcttcgattgtctgtattaccccgtttggaccatatgctgggggc
actgaacaggcaatgcctgctagtattccaccaatgtttgcatcaccggctgcccctgca
gaccccaaccagaggcagccatatgctgttcacttgaatggagctgctcctgctaacggt
acagcaaacaacacaggggtcatccctgatttgcaaatagctgtggcaggtacagtggaa
tctgctaagaggaagaggggcagacccaagcgcgtgcaagattcttctgttccttcagct
catttggttccttcagctccaggaggtaacatcactgctgtccagacgcctccttcagca
accacagatgaatctggtaagaagaagaggggacggcccaagcgggtacaagatgtacct
gtcctgtcaactccttcagctcctcaggtagatagtacagtttttcagacacctgcttct
gctgtaaatgaatctgttacgaggaaaaggggacgacccaggcgtgtacaggatggtgca
gatacttcagctcctccaattcaatcaaaatataatgagcctgttttgcagacaccttct
gctgtcaccttaccagaagatggtaagaggaagagagggcggccaaagcgtgtgcctgat
ggtgcactgattcctttaagtcactcaggtgtttcgatagatgatgacagtggtgaaata
ataacagggaaacgtggacggcctaggaaaattgatgtcaatcttctgaatctgccatct
ttgttttcagatgatcctagggaatctgttgataatgtactcatgatgtttgatgcactg
cggcggaggctcatgcagttggatgaggtgaagcaaggagcaaagcagcaacataactta
aaggccgggagtatcatgatgagtgctgaacttcgtgcaaataagaacaagaggattgga
gaggttccaggtgtcgaggttggtgatatgttctacttcagaatagagatgtgtctggtt
ggactgaatagtcagagcatgtctgggattgattacatgtctgctaagtttggtaatgag
gaggatcctgtggctatcagtatcgtgtcagctggtgtgtatgagaataccgaagatgac
ccagatgtgctggtttacactggacagggcatgtctggaaaggatgaccaaaagcttgaa
agaggtaatcttgcacttgaaaggagtttgcatagaggtaatcaaatcagagttgttcgt
agtgtaagagatttgacttgtcctactggtaagatatacatttatgatggcctttataaa
ataagagaagcatgggtggagaaaggaaaaactggctttaatgtgtttaaacacaagctg
ctcagagaacctggtcaacctgatggcatagcagtgtggaagaagactgaaaaatggagg
gagaatccttcctctcgagaccatgttatattgcgtgacatatcatatggtgcagaaagc
aagcctgtttgccttgtgaatgaagtggatgatgagaaaggtcctagccacttcaactac
acaactaaactgaactacaggaattctctcagctcaatgagaaagatgcaaggctgcaat
tgcgcaagtgtgtgccttcctggtgataacaactgctcttgcactcatcgaaatgccggt
gatcttccatacagtgcttcaggcatacttgttagccggatgcctatgctgtatgagtgt
aacgattcctgtacatgctcacataattgccggaaccgagttgtacagaaaggttctcag
atccactttgaggtgtttaagacaggagatcgaggttggggacttcgtagttgggatcca
attcgggcaggcacatttatttgtgaatatgcaggagaagttattgacagaaacagtatc
attggagaagatgattacatctttgagacaccgtcttctgagcagaatttaagatggaac
tatgcaccagaattactgggtgaacccagtctttctgactcaagtgagacacctaagcaa
ctgccaataattatcagtgcaaaacgaactggaaacatagctcgctttatgaaccacagc
tgctcaccaaatgttttttggcaaccagttttgtatgatcatggtgacgagggatatcca
catatcgcattctttgcaatcaagcatattcctccgatgacagagcttacatatgattat
ggtcagagccagggtaatgttcaactgggaatcaattctggatgtcggaagtccaaaaac
tgcttatgttggtctcgcaagtgcagaggttcctttggctaa

DBGET integrated database retrieval system