KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os12t0110000-00Help
Entry
Os12t0110000-00   CDS       T02163                                 

Gene name
Os12g0110000
Definition
Regulatory associated protein of TOR family protein.
Orthology
K07204  
regulatory associated protein of mTOR
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr12:complement(join(548525..548588,547857..547939,547622..547780,547412..547528,547122..547279,546871..547025,546629..546773,546468..546546,546233..546335,545811..545893,545597..545707,545147..545500,544887..545067,544163..544774,543717..544043,543484..543604,543262..543386,543041..543180,542843..542941,542683..542768,542447..542531,541969..542310))
AA seq 1242 aa AA seqDB search
ISVDPPDVIKISPCARKECWIDPFSMAPPKALETIGKTLHSQYERWQPKARYKLQLDPTL
EEVKKLCNTCRKFARTERVLFHYNGHGVPKPTANGEIWVFNKSYTQYIPLPITDLDSWLK
TPSIYVFDCSAAGMIVKAFLERLDWSSSSSASSSKDCILLAACEAHQTLPQSAEFPADVF
TACLTTPIKMALHWFCNRSLLRDSMEHNLIDQIPGRQNDRKTLLGELNWIFTAITDTIAW
NVLPHDLFQRLFRQDLLVASLFRNFLLAERIMRSANCSPISYPLLPPTHQHHMWDAWDMA
AEICLSKLPQLIADPNAEFQPSPFFTEQLTAFEVWLDHGSEDKKPPEQLPIVLQVLLSQS
HRFRALVLLGRFLDMGPWAVDLALSVGIFPYVLKLLQTSAMELRQILVFIWTKILSLDKS
CQVDLVKDGGHAYFIRFLDSLDAYPEQRAMAAFVLAVIVDGHRIGQEACANAGLIDVCLR
HLQPENPNDAQTEPLLLQWLCLCLGKLWEDFPEAQLLGLQSNAPEIVICLLSEPQPEVRA
SAVFALGNLVDIGSPSLNGADDDSDDDEKVRAEINVVRSLLQISSDGSPLVRSEVAVALT
RFAMGHNKHIKSVAAEYWKPQTNSLLKSLPSLANINSSNVYSPSSLIQGSSGLASHIGPV
LRVGSDNSATARDGRISTSSPIATNSIMHGSPQSDDSSQHSDSGILLRENASNGGLNYSR
SRPIDNGIYSQFIATMCNVAKDPYPRIASIGKRALSLIGVEQVSMRNSRLSNGGAHPGET
SVPPSSNFGMARSSSWFDMNSGNFSVAFRTPPVSPPQHDYLTGLRRVCSMEFRPHVLNSP
DGLADPLLSSSAAPSNMGLYILPQSLIYRWSCGHFSRPLLTGSDDNEEANARREERERIA
MDCIAKCQRSSCKMTSQIASWDTRFELGTKASLLLPFSPIVVAADENEQIRVWNYDDALP
VNTFENHKLSDRGLSKLLLINELDDSLLLVGSSDGNVRIWRNYTQKGGQKLVTAFSSVQG
YRSAGRSIVFDWQQQSGYLYASGDMSSILVWDLDKEQVNTIQSTADSGISALSASQVRCG
QFAAGFLDASVRIFDVRTPDRLVYTARPHAPRSEKVVGIGFQPGFDPYKIVSASQAGDIQ
FLDVRRASEPYLTIEAHRGSLTALAVHRHAPVIASGSAKQMIKVFSLEGEQLTIIRYQPS
FMGQRIGSVNCLSFHRYKSLLAAGAGDNALVSIYAEDNYQVR
NT seq 3729 nt NT seq  +upstreamnt  +downstreamnt
attagtgttgatccgccggatgtgatcaaaatctccccttgtgcaagaaaggagtgctgg
atagatccattttctatggcacctccaaaagcccttgaaactattgggaaaacattacac
tcacaatatgagcgctggcagccaaaggctcgttacaagcttcagctggatccgacatta
gaggaagttaagaagctatgtaatacttgccgtaaatttgctagaacagagagagtcctt
tttcattacaatggtcatggtgtaccaaagcctacagctaatggggagatttgggtattt
aacaagagttacacacagtatattccgcttcctattactgatcttgattcatggctgaaa
acaccctctatatatgtttttgactgctcagcagctggaatgatcgtgaaagcttttctg
gagcgcctagactggagttctagctcgtctgcatcttcatcgaaggactgcattctcctt
gcggcctgtgaggcacatcaaactctcccacagagcgcagaatttcctgctgatgtgttc
acagcttgcctcaccacacccatcaaaatggcactgcactggttttgtaaccgatcgtta
ctccgtgattccatggaacacaatcttatcgaccaaattcctggaaggcaaaatgaccgc
aaaactcttctaggggagttgaactggattttcactgctatcacagacactattgcatgg
aatgttcttcctcatgatctattccaaagacttttcaggcaggatcttttggttgctagt
ctctttcgcaacttcttacttgctgagagaatcatgcggtccgcaaattgttccccaatt
tcataccctttgttgccaccaactcatcagcaccatatgtgggatgcatgggacatggct
gcagagatctgcctttctaagcttcctcaattaattgctgatcctaatgcagagtttcag
ccgagtccatttttcacggagcaattgacagcatttgaagtttggcttgatcatggctct
gaagacaagaaacccccagaacagctacctattgttcttcaggttttgcttagtcagtca
cacagatttagagcacttgttctgcttggaagatttcttgacatgggaccttgggcagtt
gatttggctttgtccgttggcatcttcccttatgtacttaaactgcttcaaacaagtgca
atggagttgcgccaaattcttgtgttcatatggacaaaaattctctctcttgataagtca
tgccaggttgacttggtgaaagatggagggcatgcatactttatcaggtttcttgacagt
ttggatgcttacccagagcagcgtgcaatggctgctttcgttttagccgttattgtggat
gggcataggattggtcaagaggcttgtgctaatgcagggcttatagatgtctgcctgaga
catctgcaacctgaaaatccgaatgatgctcagacagagcctttgctcttgcaatggctt
tgtttatgccttggcaaactttgggaagatttccctgaggctcagttacttggtctgcaa
tcaaacgcaccggaaattgttatatgcttattgtcagagcctcaacctgaagtcagagct
tctgctgtttttgcacttggaaatcttgtggatattggatctccatcactgaatggagct
gacgacgattctgatgatgatgaaaaggtgagagctgaaataaatgttgtccgaagcctt
ctgcagatctcttcagatggtagccctcttgttagatctgaggttgccgtagcgcttacc
cgctttgcaatggggcacaataaacatatcaaatctgttgccgccgagtactggaaacct
caaaccaattcactgctcaagtcattaccatcgttggctaatattaattcgagcaatgtt
tacagtcccagcagcttaatacaaggtagcagtggccttgcctcacatattggtcctgtt
ttaagggttggcagtgataacagtgccactgctcgtgatggaagaatctctacgagcagc
ccgattgcaacaaatagcatcatgcatggttctccacagtcagatgattcttcccaacac
tctgattcaggcatattactgagagagaatgcaagtaatggtggtctcaactactcaaga
tcgaggcctattgataatgggatctattcccaatttatagcaactatgtgcaatgttgct
aaagatccttacccaagaattgcaagtattgggaaaagggcattgtccctcataggtgtt
gagcaagtaagcatgagaaacagtagacttagcaatggaggtgcacacccaggagagaca
tctgtgcccccttcatcaaactttggaatggcacgctcctcttcctggtttgatatgaac
tctggaaatttctcggtggcctttaggactcctcctgttagtccccctcagcatgactac
ctcacaggattgcgccgagtgtgctcgatggagttcagaccacatgttttgaactcacct
gatggcttagctgatccgcttttaagctccagtgcagcccccagcaacatggggctctat
atacttccccaatcattaatttacagatggagttgtggtcacttttctaggccacttcta
actggttctgatgataacgaggaagcaaatgctagaagagaagagcgagaacgaattgca
atggattgcattgctaaatgccaacgatcatcttgcaagatgaccagccaaattgctagc
tgggatacgaggtttgagttgggtacaaaagcatcattgttgttgccattttctcctatt
gttgttgctgcggatgaaaatgagcaaatacgagtatggaactatgacgatgcgctgcca
gtgaatacttttgaaaaccacaagttatctgacagaggcctatctaaacttttgctgatc
aatgagcttgatgatagcttgttgttagttggctcaagtgatggaaatgtccgcatatgg
agaaactatactcaaaagggaggacaaaaacttgtaactgctttttcatcagttcaaggc
tatcgaagtgctggtcgcagtattgtatttgattggcagcaacagtcgggttatctgtat
gcatctggtgacatgtcctctatccttgtatgggatcttgacaaggaacaagtcaacacc
atccagtcaactgctgatagcgggatttcagctctttctgcatctcaggttcgatgtggc
caattcgctgctggttttcttgatgcatctgttaggatatttgacgtgcgtacacctgat
aggctagtatatacagcaagaccacatgccccaagatcagaaaaggttgttggtatagga
tttcagcctgggtttgatccctacaagattgtaagtgcatctcaagctggagacattcag
ttccttgatgttagaagggcatctgaaccctacctcactattgaagcacataggggttca
ttaacggcattagctgttcatcggcatgccccagttattgcaagcggctcagccaagcag
atgatcaaagtgtttagtcttgaaggagaacagttgacaataattcgctaccagccatct
tttatgggtcaacgaataggcagcgtaaactgcctttctttccaccgatacaaatcactc
cttgccgctggtgctggtgataatgctcttgtttctatctacgcggaggacaattaccaa
gtacgatga

DBGET integrated database retrieval system