KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os12t0110000-00Help
Entry
Os12t0110000-00   CDS       T02163                                 

Gene name
Os12g0110000
Definition
(RAP-DB) Regulatory associated protein of TOR family protein.
  KO
K07204  
regulatory associated protein of mTOR
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr12:complement(join(548525..548588,547857..547939,547622..547780,547412..547528,547122..547279,546871..547025,546629..546773,546468..546546,546233..546335,545811..545893,545597..545707,545147..545500,544887..545067,544163..544774,543717..544043,543484..543604,543262..543386,543041..543180,542843..542941,542683..542768,542447..542531,541969..542310))
AA seq 1242 aa AA seqDB search
ISVDPPDVIKISPCARKECWIDPFSMAPPKALETIGKTLHSQYERWQPKARYKLQLDPTL
EEVKKLCNTCRKFARTERVLFHYNGHGVPKPTANGEIWVFNKSYTQYIPLPITDLDSWLK
TPSIYVFDCSAAGMIVKAFLERLDWSSSSSASSSKDCILLAACEAHQTLPQSAEFPADVF
TACLTTPIKMALHWFCNRSLLRDSMEHNLIDQIPGRQNDRKTLLGELNWIFTAITDTIAW
NVLPHDLFQRLFRQDLLVASLFRNFLLAERIMRSANCSPISYPLLPPTHQHHMWDAWDMA
AEICLSKLPQLIADPNAEFQPSPFFTEQLTAFEVWLDHGSEDKKPPEQLPIVLQVLLSQS
HRFRALVLLGRFLDMGPWAVDLALSVGIFPYVLKLLQTSAMELRQILVFIWTKILSLDKS
CQVDLVKDGGHAYFIRFLDSLDAYPEQRAMAAFVLAVIVDGHRIGQEACANAGLIDVCLR
HLQPENPNDAQTEPLLLQWLCLCLGKLWEDFPEAQLLGLQSNAPEIVICLLSEPQPEVRA
SAVFALGNLVDIGSPSLNGADDDSDDDEKVRAEINVVRSLLQISSDGSPLVRSEVAVALT
RFAMGHNKHIKSVAAEYWKPQTNSLLKSLPSLANINSSNVYSPSSLIQGSSGLASHIGPV
LRVGSDNSATARDGRISTSSPIATNSIMHGSPQSDDSSQHSDSGILLRENASNGGLNYSR
SRPIDNGIYSQFIATMCNVAKDPYPRIASIGKRALSLIGVEQVSMRNSRLSNGGAHPGET
SVPPSSNFGMARSSSWFDMNSGNFSVAFRTPPVSPPQHDYLTGLRRVCSMEFRPHVLNSP
DGLADPLLSSSAAPSNMGLYILPQSLIYRWSCGHFSRPLLTGSDDNEEANARREERERIA
MDCIAKCQRSSCKMTSQIASWDTRFELGTKASLLLPFSPIVVAADENEQIRVWNYDDALP
VNTFENHKLSDRGLSKLLLINELDDSLLLVGSSDGNVRIWRNYTQKGGQKLVTAFSSVQG
YRSAGRSIVFDWQQQSGYLYASGDMSSILVWDLDKEQVNTIQSTADSGISALSASQVRCG
QFAAGFLDASVRIFDVRTPDRLVYTARPHAPRSEKVVGIGFQPGFDPYKIVSASQAGDIQ
FLDVRRASEPYLTIEAHRGSLTALAVHRHAPVIASGSAKQMIKVFSLEGEQLTIIRYQPS
FMGQRIGSVNCLSFHRYKSLLAAGAGDNALVSIYAEDNYQVR
NT seq 3729 nt NT seq  +upstreamnt  +downstreamnt
attagtgttgatccgccggatgtgatcaaaatctccccttgtgcaagaaaggagtgctgg
atagatccattttctatggcacctccaaaagcccttgaaactattgggaaaacattacac
tcacaatatgagcgctggcagccaaaggctcgttacaagcttcagctggatccgacatta
gaggaagttaagaagctatgtaatacttgccgtaaatttgctagaacagagagagtcctt
tttcattacaatggtcatggtgtaccaaagcctacagctaatggggagatttgggtattt
aacaagagttacacacagtatattccgcttcctattactgatcttgattcatggctgaaa
acaccctctatatatgtttttgactgctcagcagctggaatgatcgtgaaagcttttctg
gagcgcctagactggagttctagctcgtctgcatcttcatcgaaggactgcattctcctt
gcggcctgtgaggcacatcaaactctcccacagagcgcagaatttcctgctgatgtgttc
acagcttgcctcaccacacccatcaaaatggcactgcactggttttgtaaccgatcgtta
ctccgtgattccatggaacacaatcttatcgaccaaattcctggaaggcaaaatgaccgc
aaaactcttctaggggagttgaactggattttcactgctatcacagacactattgcatgg
aatgttcttcctcatgatctattccaaagacttttcaggcaggatcttttggttgctagt
ctctttcgcaacttcttacttgctgagagaatcatgcggtccgcaaattgttccccaatt
tcataccctttgttgccaccaactcatcagcaccatatgtgggatgcatgggacatggct
gcagagatctgcctttctaagcttcctcaattaattgctgatcctaatgcagagtttcag
ccgagtccatttttcacggagcaattgacagcatttgaagtttggcttgatcatggctct
gaagacaagaaacccccagaacagctacctattgttcttcaggttttgcttagtcagtca
cacagatttagagcacttgttctgcttggaagatttcttgacatgggaccttgggcagtt
gatttggctttgtccgttggcatcttcccttatgtacttaaactgcttcaaacaagtgca
atggagttgcgccaaattcttgtgttcatatggacaaaaattctctctcttgataagtca
tgccaggttgacttggtgaaagatggagggcatgcatactttatcaggtttcttgacagt
ttggatgcttacccagagcagcgtgcaatggctgctttcgttttagccgttattgtggat
gggcataggattggtcaagaggcttgtgctaatgcagggcttatagatgtctgcctgaga
catctgcaacctgaaaatccgaatgatgctcagacagagcctttgctcttgcaatggctt
tgtttatgccttggcaaactttgggaagatttccctgaggctcagttacttggtctgcaa
tcaaacgcaccggaaattgttatatgcttattgtcagagcctcaacctgaagtcagagct
tctgctgtttttgcacttggaaatcttgtggatattggatctccatcactgaatggagct
gacgacgattctgatgatgatgaaaaggtgagagctgaaataaatgttgtccgaagcctt
ctgcagatctcttcagatggtagccctcttgttagatctgaggttgccgtagcgcttacc
cgctttgcaatggggcacaataaacatatcaaatctgttgccgccgagtactggaaacct
caaaccaattcactgctcaagtcattaccatcgttggctaatattaattcgagcaatgtt
tacagtcccagcagcttaatacaaggtagcagtggccttgcctcacatattggtcctgtt
ttaagggttggcagtgataacagtgccactgctcgtgatggaagaatctctacgagcagc
ccgattgcaacaaatagcatcatgcatggttctccacagtcagatgattcttcccaacac
tctgattcaggcatattactgagagagaatgcaagtaatggtggtctcaactactcaaga
tcgaggcctattgataatgggatctattcccaatttatagcaactatgtgcaatgttgct
aaagatccttacccaagaattgcaagtattgggaaaagggcattgtccctcataggtgtt
gagcaagtaagcatgagaaacagtagacttagcaatggaggtgcacacccaggagagaca
tctgtgcccccttcatcaaactttggaatggcacgctcctcttcctggtttgatatgaac
tctggaaatttctcggtggcctttaggactcctcctgttagtccccctcagcatgactac
ctcacaggattgcgccgagtgtgctcgatggagttcagaccacatgttttgaactcacct
gatggcttagctgatccgcttttaagctccagtgcagcccccagcaacatggggctctat
atacttccccaatcattaatttacagatggagttgtggtcacttttctaggccacttcta
actggttctgatgataacgaggaagcaaatgctagaagagaagagcgagaacgaattgca
atggattgcattgctaaatgccaacgatcatcttgcaagatgaccagccaaattgctagc
tgggatacgaggtttgagttgggtacaaaagcatcattgttgttgccattttctcctatt
gttgttgctgcggatgaaaatgagcaaatacgagtatggaactatgacgatgcgctgcca
gtgaatacttttgaaaaccacaagttatctgacagaggcctatctaaacttttgctgatc
aatgagcttgatgatagcttgttgttagttggctcaagtgatggaaatgtccgcatatgg
agaaactatactcaaaagggaggacaaaaacttgtaactgctttttcatcagttcaaggc
tatcgaagtgctggtcgcagtattgtatttgattggcagcaacagtcgggttatctgtat
gcatctggtgacatgtcctctatccttgtatgggatcttgacaaggaacaagtcaacacc
atccagtcaactgctgatagcgggatttcagctctttctgcatctcaggttcgatgtggc
caattcgctgctggttttcttgatgcatctgttaggatatttgacgtgcgtacacctgat
aggctagtatatacagcaagaccacatgccccaagatcagaaaaggttgttggtatagga
tttcagcctgggtttgatccctacaagattgtaagtgcatctcaagctggagacattcag
ttccttgatgttagaagggcatctgaaccctacctcactattgaagcacataggggttca
ttaacggcattagctgttcatcggcatgccccagttattgcaagcggctcagccaagcag
atgatcaaagtgtttagtcttgaaggagaacagttgacaataattcgctaccagccatct
tttatgggtcaacgaataggcagcgtaaactgcctttctttccaccgatacaaatcactc
cttgccgctggtgctggtgataatgctcttgtttctatctacgcggaggacaattaccaa
gtacgatga

DBGET integrated database retrieval system