KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os12t0182200-01Help
Entry
Os12t0182200-01   CDS       T02163                                 

Gene name
Os12g0182200
Definition
Similar to Dihydrolipoamide S-acetyltransferase.
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:dosa01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dosa00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:dosa00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dosa00620]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr12:complement(join(4175932..4176795,4175652..4175843,4175475..4175562,4172681..4172751,4172507..4172590,4172306..4172410))
AA seq 467 aa AA seqDB search
MAALLHLQSSATAAAAPSFLLLRRRGGGVTAPAGSSRRRRACFRVEAKIREIFMPALSST
MTEGKIVSWTASEGDRLAKGDPVVVVESDKADMDVETFHDGFLAAVLVPAGESAPVGSAI
ALLAESEDEIPAAQSKAASLSSSSSSSPPPPPPQESTPPPPPPPPPAPVAAAVSAPAPPS
PASQGGLRVVASPYARKLAKDLNVDLNSITGSGPGGRIVAKDVEAAAAAPKKAAPVAAAR
PDVPLGSTVPFTTMQGAVSKNMVESLAVPTFRVGYTFTTDALDALYKKIKPKGVTMSALL
AKATAMALVQHPVINSSCRDGKSFTYNSSINIAVAVAIDGGLITPVLPDADKLDIYSLSR
KWKELVDKARAKQLQPHEYNSGTFTISNLGMFGVDRFDAILPPGTGAIMAVGSSQPTLVG
TKDGSIGIKNQMQVNVTADHRVIYGADLAAFLQTLSKIIEDPKDLTF
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggccgccctcctccacctccagtcctccgccaccgccgccgcggcgccctccttcctc
ctcctccgccgccgcggcggcggcgtcacggcgccggcagggagcagccggcggcggcgg
gcgtgcttccgcgtggaggcgaagatccgggagatcttcatgccggcgctgagctcgacc
atgacggaggggaagatcgtgtcgtggacggcctccgagggggaccgcctcgccaagggc
gaccccgtcgtcgtcgtcgagtccgacaaggccgacatggacgtcgagaccttccacgac
ggcttcctcgccgccgtcctcgtccccgccggcgagtccgcccccgtcggctccgccatc
gcgctcctcgccgagtccgaggacgagatccccgccgcccagtccaaggccgcctccctc
tcctcctcctcctcctcctctccaccacctccgcctccccaagaatcaacccctccccct
cccccgccacctcctccagcgccagtagcagcagcagtctccgctcccgcgcctccatcc
ccagcctcgcaaggcggcttgcgcgtggtcgcgtcgccgtacgccaggaagctagccaag
gacctcaacgtcgatctcaactccattaccggctctggccctggcgggcggatagtggcc
aaggacgtcgaggcggcggcggctgcgccaaagaaggcggcgcccgtggcggctgctcgg
cccgatgtgccgctgggttcgacggtgccattcacgacaatgcagggtgccgtcagcaag
aacatggtggagagcctcgccgtgccgacgttcagagtcggttacaccttcacaaccgat
gctctggatgcactctacaagaagattaagccgaagggtgtgacaatgtcggccctgttg
gcgaaggcgactgcaatggcgctcgtgcaacacccggttataaactccagctgcagagat
gggaagagcttcacttacaacagcagcataaacatcgctgtggcagtggccatcgatggt
gggttgattacgccagtgcttcctgatgctgataagctcgacatttattctttgtcgagg
aaatggaaggagttagtcgataaggctcgagcgaagcagctacagccccatgaatacaat
tctggcacctttactatttcaaaccttggtatgtttggagttgacagatttgatgcaatc
ttgccacctggaactggtgcaatcatggccgttggatcatcacaaccaacacttgttggt
acaaaagatggtagtattgggatcaagaaccaaatgcaggtcaatgttactgctgatcat
cgggttatttacggagctgatcttgccgcttttctgcaaactctttccaagataattgag
gatcccaaggaccttacattttag

DBGET integrated database retrieval system