KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os12t0182200-01Help
Entry
Os12t0182200-01   CDS       T02163                                 

Gene name
Os12g0182200
Definition
(RAP-DB) Similar to Dihydrolipoamide S-acetyltransferase.
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00010  Glycolysis / Gluconeogenesis
dosa00020  Citrate cycle (TCA cycle)
dosa00620  Pyruvate metabolism
dosa01100  Metabolic pathways
dosa01110  Biosynthesis of secondary metabolites
dosa01200  Carbon metabolism
Module
dosa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Os12t0182200-01 (Os12g0182200)
   00020 Citrate cycle (TCA cycle)
    Os12t0182200-01 (Os12g0182200)
   00620 Pyruvate metabolism
    Os12t0182200-01 (Os12g0182200)
Enzymes [BR:dosa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Os12t0182200-01 (Os12g0182200)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl
Motif
Other DBs
RAP-DB: Os12t0182200-01
Position
chr12:complement(join(4175932..4176795,4175652..4175843,4175475..4175562,4172681..4172751,4172507..4172590,4172306..4172410))
AA seq 467 aa AA seqDB search
MAALLHLQSSATAAAAPSFLLLRRRGGGVTAPAGSSRRRRACFRVEAKIREIFMPALSST
MTEGKIVSWTASEGDRLAKGDPVVVVESDKADMDVETFHDGFLAAVLVPAGESAPVGSAI
ALLAESEDEIPAAQSKAASLSSSSSSSPPPPPPQESTPPPPPPPPPAPVAAAVSAPAPPS
PASQGGLRVVASPYARKLAKDLNVDLNSITGSGPGGRIVAKDVEAAAAAPKKAAPVAAAR
PDVPLGSTVPFTTMQGAVSKNMVESLAVPTFRVGYTFTTDALDALYKKIKPKGVTMSALL
AKATAMALVQHPVINSSCRDGKSFTYNSSINIAVAVAIDGGLITPVLPDADKLDIYSLSR
KWKELVDKARAKQLQPHEYNSGTFTISNLGMFGVDRFDAILPPGTGAIMAVGSSQPTLVG
TKDGSIGIKNQMQVNVTADHRVIYGADLAAFLQTLSKIIEDPKDLTF
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggccgccctcctccacctccagtcctccgccaccgccgccgcggcgccctccttcctc
ctcctccgccgccgcggcggcggcgtcacggcgccggcagggagcagccggcggcggcgg
gcgtgcttccgcgtggaggcgaagatccgggagatcttcatgccggcgctgagctcgacc
atgacggaggggaagatcgtgtcgtggacggcctccgagggggaccgcctcgccaagggc
gaccccgtcgtcgtcgtcgagtccgacaaggccgacatggacgtcgagaccttccacgac
ggcttcctcgccgccgtcctcgtccccgccggcgagtccgcccccgtcggctccgccatc
gcgctcctcgccgagtccgaggacgagatccccgccgcccagtccaaggccgcctccctc
tcctcctcctcctcctcctctccaccacctccgcctccccaagaatcaacccctccccct
cccccgccacctcctccagcgccagtagcagcagcagtctccgctcccgcgcctccatcc
ccagcctcgcaaggcggcttgcgcgtggtcgcgtcgccgtacgccaggaagctagccaag
gacctcaacgtcgatctcaactccattaccggctctggccctggcgggcggatagtggcc
aaggacgtcgaggcggcggcggctgcgccaaagaaggcggcgcccgtggcggctgctcgg
cccgatgtgccgctgggttcgacggtgccattcacgacaatgcagggtgccgtcagcaag
aacatggtggagagcctcgccgtgccgacgttcagagtcggttacaccttcacaaccgat
gctctggatgcactctacaagaagattaagccgaagggtgtgacaatgtcggccctgttg
gcgaaggcgactgcaatggcgctcgtgcaacacccggttataaactccagctgcagagat
gggaagagcttcacttacaacagcagcataaacatcgctgtggcagtggccatcgatggt
gggttgattacgccagtgcttcctgatgctgataagctcgacatttattctttgtcgagg
aaatggaaggagttagtcgataaggctcgagcgaagcagctacagccccatgaatacaat
tctggcacctttactatttcaaaccttggtatgtttggagttgacagatttgatgcaatc
ttgccacctggaactggtgcaatcatggccgttggatcatcacaaccaacacttgttggt
acaaaagatggtagtattgggatcaagaaccaaatgcaggtcaatgttactgctgatcat
cgggttatttacggagctgatcttgccgcttttctgcaaactctttccaagataattgag
gatcccaaggaccttacattttag

DBGET integrated database retrieval system