KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os12t0183200-00Help
Entry
Os12t0183200-00   CDS       T02163                                 

Gene name
Os12g0183200
Definition
Similar to 3'(2'),5'-bisphosphate nucleotidase.
Orthology
K15422  
3'(2'), 5'-bisphosphate nucleotidase / inositol polyphosphate 1-phosphatase [EC:3.1.3.7 3.1.3.57]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Os12t0183200-00 (Os12g0183200)
  Energy metabolism
   00920 Sulfur metabolism
    Os12t0183200-00 (Os12g0183200)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    Os12t0183200-00 (Os12g0183200)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Os12t0183200-00 (Os12g0183200)
    3.1.3.57  inositol-1,4-bisphosphate 1-phosphatase
     Os12t0183200-00 (Os12g0183200)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr12:complement(join(4216249..4216353,4215961..4216036,4215721..4215794,4215430..4215632,4213910..4214117,4213469..4213622,4213199..4213362))
AA seq 327 aa AA seqDB search
MSELPSPPPPAAGNQYGAEHAAAKKAVALAARLCKKVQQDLLKLDVQTKADRTPVTVADY
GSQVLVSVVLKIELPSNSFSMVAEEDSEDLRKDGAQEMLGHITKLVNETIINDGSYSITL
SKEDVLVAIDGGKSEGGPSGRYWILDPIDGTKGFIRGDQYAIGLALLDEGKVVLGAMACP
NLPFKSIDHNGGSSGDQVGALFSATIGCGSTVESLEGSQPQKKLGIQAPPVRIDSQAKYG
AVAQGDGAIYWRFPHKRSKEAVWDHAAGSIIVTEAGGLVKDASGNDLDFSKGRYLDRDAG
IIATNKYLMPLVVKAAQEAMKEEGILG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagctgccatcgccgccgccgccggccgccggcaaccagtacggagcggagcac
gccgccgccaagaaggccgtcgccctcgccgcccgcctctgcaagaaagtgcagcaggac
ctcttgaaattggacgttcaaactaaggctgacagaacaccggtgacagtcgccgattat
ggatcacaggtattggtaagtgtggtcctgaagattgaattaccttctaactccttttcc
atggtggctgaagaggattctgaagacttgaggaaagatggagctcaagaaatgttggga
catatcaccaaacttgtgaacgaaaccatcataaatgatggttcgtacagcatcacatta
tctaaggaagatgtgctggtagcaatcgatggtggaaaatctgagggtggaccttctggg
cgatattggatattggatccgatagatggaactaagggtttcataaggggagaccaatat
gcaattggacttgcattactggacgaaggcaaagtagttttgggagcaatggcatgccca
aatcttcctttcaaatcaatagatcacaatggtggatcttcgggagatcaagttggtgcc
ctcttttctgctacaattggctgtggatctacagttgagtccttagaaggctctcagcca
caaaagaaacttggtattcaagctcctccagttagaattgatagccaagcaaaatatggt
gctgtagcccaaggtgatggcgccatttattggcgatttccacacaaacgttccaaagaa
gcagtatgggatcatgcagctgggtctattattgtcacagaagctggaggtttggtaaaa
gatgcttcaggaaacgatttggatttctccaaaggtagatatcttgatcgtgatgctggc
attattgcaacaaataaatatttgatgccattagttgtaaaagctgcccaagaggctatg
aaggaggaaggaatactaggctga

DBGET integrated database retrieval system