KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os12t0446900-01Help
Entry
Os12t0446900-01   CDS       T02163                                 

Gene name
Os12g0446900
Definition
Similar to bifunctional dihydrofolate reductase-thymidylate synthase.
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Os12t0446900-01 (Os12g0446900)
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Os12t0446900-01 (Os12g0446900)
   00670 One carbon pool by folate
    Os12t0446900-01 (Os12g0446900)
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Os12t0446900-01 (Os12g0446900)
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     Os12t0446900-01 (Os12g0446900)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr12:join(15134326..15134735,15134837..15135236,15135314..15135358,15136196..15136261,15137519..15137580,15137663..15137737,15137851..15138016,15139074..15139197,15139867..15139973,15140085..15140195)
AA seq 521 aa AA seqDB search
MSTNVNNGNSESNLKRSYQVVVSATRDMGIGKDGTLPWKLPGDLKFFKDITVTTSDPSKK
NAVVMGRKTWESIPLKFRPLPGRLNVILTRSGSFDFATAENVVICGSLDSALQLLATTPY
CLTVEKTFIIGGGEILRQSLNAPACEAIHLTDIESSIECDTFIPPIDLSMFHPWYSSFPV
VENGIKHSFISFVRVTKSIAEANDSSGKELTGNDSKKVKFEIENFSFLPKMIFERHEEYQ
YLNLVQDIIRNGAKKNDRTGTGTVSKFGCQMRFNLRRNFPLLTTKRVFWRGVLEELLWFI
SGSTNAKVLQEKGIHIWDGNASRQYLDSIGLTQREEGDLGPVYGFQWRHFGAEYTDMHAD
YVGKGFDQLMDVIDKIKNNPDDRRIILSAWNPTDLKKMALPPCHMFAQFYVENGELSCQM
YQRSADMGLGVPFNIASYSLLTCMIAQVCDLSPGDFVHVIGDAHVYRTHVEALEEQMRKQ
PKPFPILKINPVKKDIDSFVTSDFKLVRYDPHHKIEMKMAV
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgtctacaaatgttaacaatggtaactcagagagcaaccttaagagaagttatcaagtt
gtggtttctgctactcgcgacatgggtattgggaaggatgggacgctgccatggaagctg
ccgggtgacctgaagttttttaaagatattacagtgactacgtcagacccttcaaagaaa
aatgctgttgtaatgggaaggaaaacatgggaaagcataccccttaagtttagaccactc
cctggtcgtttgaatgtaatattgactcgttctgggagttttgattttgcaactgcagaa
aatgttgttatctgtgggagtttggattctgccttgcaactgctagcaacaactccatac
tgtttgacagttgagaaaacttttataataggaggtggcgagattctgaggcaatcttta
aatgcgcctgcttgtgaggccatccatcttaccgacatagagtccagcattgaatgtgat
actttcattcctccaattgatctctccatgttccacccatggtattcatcatttccagtg
gtagaaaacggcatcaagcattctttcatttcctttgttcgtgttacaaaatcaattgca
gaagctaatgattctagtggcaaggaattgactggaaatgattctaagaaggtcaagttt
gaaattgagaatttttcctttttacctaaaatgatatttgaaaggcacgaggagtatcaa
tatctcaatcttgttcaagatataataagaaatggtgctaagaaaaatgacagaacagga
acagggacagtatcaaagtttggttgccagatgcggttcaacttaaggaggaactttcca
ttgctcacaacgaagagggtattttggcgtggtgttcttgaagagctattgtggttcatt
agtggctcaacaaatgcaaaggttttacaggagaaaggtattcacatatgggatggcaat
gcttcaaggcagtatcttgacagtattggtttaacacaaagggaggagggggacttggga
ccagtttatggatttcagtggagacactttggtgctgaatatactgacatgcatgctgac
tacgtgggaaaaggttttgatcagttaatggatgtcattgacaagatcaagaataatccc
gatgatagaagaatcattttatctgcatggaatccaacagacctgaaaaagatggccctg
ccaccatgccacatgtttgctcagttttatgttgagaatggggagttgtcatgccagatg
taccaacgctctgctgatatggggctcggtgtgccattcaacattgcatcatattctctt
ctgacatgtatgattgcacaagtgtgtgatctttctcctggggattttgtccatgttata
ggtgatgcccatgtttaccgtacgcatgttgaagcgttagaggagcaaatgcggaagcag
cctaaaccattccctattttgaagataaatcctgtgaagaaagatattgattcttttgta
acatcagacttcaaactggttcgctatgatcctcaccataagatagaaatgaagatggca
gtatga

DBGET integrated database retrieval system