KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os12t0446900-01Help
Entry
Os12t0446900-01   CDS       T02163                                 

Gene name
Os12g0446900
Definition
Similar to bifunctional dihydrofolate reductase-thymidylate synthase.
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:dosa00240]
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dosa00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:dosa00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr12:join(15134326..15134735,15134837..15135236,15135314..15135358,15136196..15136261,15137519..15137580,15137663..15137737,15137851..15138016,15139074..15139197,15139867..15139973,15140085..15140195)
AA seq 521 aa AA seqDB search
MSTNVNNGNSESNLKRSYQVVVSATRDMGIGKDGTLPWKLPGDLKFFKDITVTTSDPSKK
NAVVMGRKTWESIPLKFRPLPGRLNVILTRSGSFDFATAENVVICGSLDSALQLLATTPY
CLTVEKTFIIGGGEILRQSLNAPACEAIHLTDIESSIECDTFIPPIDLSMFHPWYSSFPV
VENGIKHSFISFVRVTKSIAEANDSSGKELTGNDSKKVKFEIENFSFLPKMIFERHEEYQ
YLNLVQDIIRNGAKKNDRTGTGTVSKFGCQMRFNLRRNFPLLTTKRVFWRGVLEELLWFI
SGSTNAKVLQEKGIHIWDGNASRQYLDSIGLTQREEGDLGPVYGFQWRHFGAEYTDMHAD
YVGKGFDQLMDVIDKIKNNPDDRRIILSAWNPTDLKKMALPPCHMFAQFYVENGELSCQM
YQRSADMGLGVPFNIASYSLLTCMIAQVCDLSPGDFVHVIGDAHVYRTHVEALEEQMRKQ
PKPFPILKINPVKKDIDSFVTSDFKLVRYDPHHKIEMKMAV
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgtctacaaatgttaacaatggtaactcagagagcaaccttaagagaagttatcaagtt
gtggtttctgctactcgcgacatgggtattgggaaggatgggacgctgccatggaagctg
ccgggtgacctgaagttttttaaagatattacagtgactacgtcagacccttcaaagaaa
aatgctgttgtaatgggaaggaaaacatgggaaagcataccccttaagtttagaccactc
cctggtcgtttgaatgtaatattgactcgttctgggagttttgattttgcaactgcagaa
aatgttgttatctgtgggagtttggattctgccttgcaactgctagcaacaactccatac
tgtttgacagttgagaaaacttttataataggaggtggcgagattctgaggcaatcttta
aatgcgcctgcttgtgaggccatccatcttaccgacatagagtccagcattgaatgtgat
actttcattcctccaattgatctctccatgttccacccatggtattcatcatttccagtg
gtagaaaacggcatcaagcattctttcatttcctttgttcgtgttacaaaatcaattgca
gaagctaatgattctagtggcaaggaattgactggaaatgattctaagaaggtcaagttt
gaaattgagaatttttcctttttacctaaaatgatatttgaaaggcacgaggagtatcaa
tatctcaatcttgttcaagatataataagaaatggtgctaagaaaaatgacagaacagga
acagggacagtatcaaagtttggttgccagatgcggttcaacttaaggaggaactttcca
ttgctcacaacgaagagggtattttggcgtggtgttcttgaagagctattgtggttcatt
agtggctcaacaaatgcaaaggttttacaggagaaaggtattcacatatgggatggcaat
gcttcaaggcagtatcttgacagtattggtttaacacaaagggaggagggggacttggga
ccagtttatggatttcagtggagacactttggtgctgaatatactgacatgcatgctgac
tacgtgggaaaaggttttgatcagttaatggatgtcattgacaagatcaagaataatccc
gatgatagaagaatcattttatctgcatggaatccaacagacctgaaaaagatggccctg
ccaccatgccacatgtttgctcagttttatgttgagaatggggagttgtcatgccagatg
taccaacgctctgctgatatggggctcggtgtgccattcaacattgcatcatattctctt
ctgacatgtatgattgcacaagtgtgtgatctttctcctggggattttgtccatgttata
ggtgatgcccatgtttaccgtacgcatgttgaagcgttagaggagcaaatgcggaagcag
cctaaaccattccctattttgaagataaatcctgtgaagaaagatattgattcttttgta
acatcagacttcaaactggttcgctatgatcctcaccataagatagaaatgaagatggca
gtatga

DBGET integrated database retrieval system