KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os12t0489100-01Help
Entry
Os12t0489100-01   CDS       T02163                                 

Gene name
Os12g0489100
Definition
Similar to Ubiquitin-specific protease 12.
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr12:join(18334846..18334875,18335139..18335232,18335388..18335538,18335642..18335799,18337798..18338063,18338143..18338361,18338427..18338535,18338606..18338721,18339053..18339151,18340565..18340674,18341111..18341185,18342046..18342124,18342245..18342391)
AA seq 551 aa AA seqDB search
MTMMTPPPIEQQQQEDEEMLVPHQELPAAAAVVADAVQPMEVVAQTEPANAAESQPPEDP
QTSRFTWTIENFTRINGKKHYSEPFVVGGFKWRVLIFPKGNNVDHFSMYLDVADSVNLPY
GWNRYAQFSLAVVNQIHPKYTIRKDTQHQFNARESDWGFTSFMPLSDLYDPSRGYLVNDT
VVVEAEVAVRRMVDYWTYDSKKETGYVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPT
TENDMPSGSIPLALQSLFYKLQYSDNSVATKELTKSFGWDTYDSFMQHDVQELNRVLCEK
LEDKMKETVVEGTIEQLFEGHHINYIECINVDYKSNRKESFYDLQLDVKGCSDVYASFDK
YVEVERLEGDNKYHAEQYGLQDAKKGVLFLDFPPVLQLQLKRFEYDYMRDTMVKINDRYE
FPLQLDLDRDDGKYLAPDADRSIRNLYTLHSVLVHSGGVHGGHYYAFIRPTLSDQWYKFD
DERVTKEDTKKALEEQYGGEEELPQINPGFNNTPFKFTKYSNAYMLVYIRESDKDKIMCN
VDEKDIAEHLR
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgactatgatgactcctccccccatcgagcagcagcagcaggaggacgaggagatgctc
gtgccgcaccaggagctccccgccgccgccgctgtcgtcgccgacgccgtgcagccgatg
gaagttgtggcgcagacagagcctgccaacgcggcagagagccagccgccggaggacccg
cagacgtcgcggttcacgtggacgatcgagaacttcaccaggatcaacgggaagaagcac
tactcggagccgtttgttgttggaggattcaaatggcgtgtgctgattttccctaagggg
aacaatgtggaccatttctctatgtatttggatgtcgcggactcggtgaatctcccttat
ggatggaaccggtatgctcagttcagcttggctgttgtgaaccagatccatccgaagtat
accattcggaaagatactcaacatcaatttaatgcacgtgagagtgactggggtttcaca
tcttttatgcctttgagtgatctgtatgacccaagtaggggctaccttgttaatgacacc
gttgttgtggaagctgaggttgctgttcgcagaatggttgattactggacttatgactcg
aaaaaggaaacaggatatgttggtctaaagaatcaaggagctacctgttatatgaactct
cttctacaaacactgtaccatataccatatttcaggaaggctgtatatcatatgccaact
actgagaatgacatgccatctgggagtattcctttagccctgcagagccttttttacaag
ctccaatacagcgacaatagcgtagctacaaaggagttgaccaaatcttttggatgggac
acttatgattctttcatgcagcatgatgttcaagagcttaacagagttctttgtgagaaa
cttgaagacaaaatgaaggaaactgttgtggaaggaacaattgaacaattatttgaaggc
caccacataaactatatcgagtgcattaatgttgattataaatctaacagaaaagaatcc
ttttatgatctacagcttgatgtcaaaggttgtagtgatgtttatgcatcatttgataaa
tatgtcgaagtggagcgtctagagggtgataacaaatatcatgcagagcagtatggctta
caggatgcaaagaagggagtactcttccttgatttccctcctgttttgcaacttcaactg
aagcgttttgaatatgattacatgcgagatacaatggtcaagattaatgaccggtatgag
ttcccacttcaacttgatcttgacagagatgatgggaaatatcttgctcctgatgcagat
agaagcattagaaacctttacactcttcacagtgttcttgttcatagcggaggagtacat
ggcggtcactactatgctttcatacggcctacgctatcagaccagtggtataaatttgat
gatgaacgagtaacaaaagaagataccaaaaaagcccttgaagagcagtatgggggtgaa
gaagagttgcctcaaataaaccctggtttcaataacaccccatttaaattcacaaagtat
tcgaatgcctacatgcttgtctatattcgtgagagcgacaaggataaaataatgtgtaat
gttgatgaaaaggacatcgctgagcatttgcgg

DBGET integrated database retrieval system