KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os12t0562400-00Help
Entry
Os12t0562400-00   CDS       T02163                                 

Gene name
Os12g0562400
Definition
Similar to Phospholipase C (Fragment).
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Os12t0562400-00 (Os12g0562400)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    Os12t0562400-00 (Os12g0562400)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     Os12t0562400-00 (Os12g0562400)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr12:join(23048934..23049260,23049704..23049900,23050703..23050838,23050915..23051151,23051242..23051465,23051791..23051908,23052437..23052676,23052780..23053073)
AA seq 590 aa AA seqDB search
MGSYAYKYCMCFTRKFRSPAADPPPDVRAAFLAAGGGDGGLRRFLAQAQGETPAEVDRIL
ALLSGGGGGGGGGGIAARLVGPRPGPAPSLDDFFGFLFNADLNPPIATQVHQDMSAPFSH
YYIYTGHNSYLTGNQLNSDSSDIPIIKALQRGVRVIELDMWPNSAKNNIDILHGGTLTAP
VQIIKCLKSIKEYAFCASPYPLVITLEDHLTPDLQAKVAEMLVKTFGNLLYIPSSDPINE
FPSPESLMKKIIISTKPPEEYKKFLKSKDNQNINGGLANLAEEGSLRRIDSNAEESDGKD
ELDDQDEDSSDEDDPKFQQETACEYRELITIHAGKPKGHLKDALKVDPDKVRRLSLSETQ
LAKATASHGADVIRFTQKNILRVYPKGTRINSSNYDPMNAWTHGAQMVAFNMQGHDKALR
LMQGFFRANGGCGYVKKPDFLLRTGPNGEVFDPNASMPVKKTLKVKVYMGDGWRMDFSKT
HFDTFSPPDFYTRVGIAGVRADCVMKKTRTIEDQWVPMWDEEFTFPLTVPELAVLRIEVH
EYDMSEKHDFGGQTCLPVSELKQGIRAVPLHDRRGTRYKSVRLLMRFDFL
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggggagctacgcgtacaagtactgcatgtgcttcacccgcaagttccgctcgccggcg
gccgacccgccgccggacgtccgcgccgccttcctcgccgccggcggaggcgacggcggg
ctccggcggttcctcgcgcaggcgcagggggagacgccggcggaggtggaccgcatcctc
gcgctgctcagcggcggtggcggcggcggcggaggaggaggcatcgcggcccgcctcgtg
ggcccccggcccggcccggccccctcgctcgacgacttctttgggttcctcttcaacgcc
gatctcaacccacccatcgccacccaggttcaccaggacatgtcggcgccgttttcgcac
tattacatatacaccgggcacaattcctacttgactgggaaccagctgaacagtgattcc
agcgacattccgattatcaaagcattgcagaggggtgtcagggtgattgagctcgatatg
tggccgaattccgctaagaacaacattgacattcttcatggagggacattgactgcacct
gtacaaatcatcaaatgtttgaagtccattaaagaatacgccttttgtgcttcaccatat
cctcttgtcattactcttgaggatcacctcacaccggacctccaagctaaagtagctgag
atgctcgtcaaaacatttggaaatctcctttacattcctagttcagacccaataaatgag
tttccttctccagaatctctaatgaagaaaataatcatctcaactaaaccaccagaagaa
tacaagaagtttcttaaatctaaggataatcagaacatcaatggcggcttagctaatctg
gcagaggaaggaagcttgagaagaatagattcaaatgctgaagaatcggatggaaaggat
gaactggatgatcaagatgaggactcctctgatgaggatgatcccaaatttcagcaggaa
acagcctgtgagtatagggaactgatcaccatccacgctggcaaaccaaaaggccatttg
aaggatgcgcttaaggtggatcctgacaaagtcaggcgcctttctttgagcgaaacacag
ctagctaaagcaacagcttctcatggtgccgatgttataaggttcacccagaagaatata
ctcagggtgtatccgaagggtacaaggattaattcttccaactatgatccaatgaatgcc
tggactcatggtgctcagatggttgcatttaacatgcaggggcatgacaaagcactccgg
ttaatgcaaggattttttagagctaatggaggttgtggctatgtcaaaaagcctgacttc
ttgcttaggacaggtccaaatggtgaagtatttgaccctaacgcaagtatgcctgtgaag
aaaactctgaaggtgaaagtatatatgggagatggatggcgaatggatttcagtaaaact
catttcgacaccttctctcctcctgatttctatactagggtggggatcgctggtgtgcgg
gcagattgtgtgatgaagaagactcgaacaatcgaggatcagtgggtaccgatgtgggat
gaggagttcacattccctctgacagtcccggagctggctgtgctgagaatcgaggttcat
gagtacgacatgtcggagaagcatgactttggggggcagacatgcctgccagtgtcggag
ctgaagcagggcatccgcgctgtgcctctccacgatcgccggggcaccaggtacaagtct
gtcaggctcctcatgcgcttcgacttcctctag

DBGET integrated database retrieval system