KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os12t0563700-01Help
Entry
Os12t0563700-01   CDS       T02163                                 

Gene name
Os12g0563700
Definition
Pectin lyase fold domain containing protein.
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Os12t0563700-01 (Os12g0563700)
   00500 Starch and sucrose metabolism
    Os12t0563700-01 (Os12g0563700)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Os12t0563700-01 (Os12g0563700)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr12:complement(join(23122156..23122592,23121224..23121413,23120886..23121092,23119975..23120219,23119167..23119332))
AA seq 414 aa AA seqDB search
MEIISPSSSSNNNSPVLATFLVVLVVLLASSRPASSQNQQSFTINPGGAAAARPGGGKGG
GGGGGPGSFSDFLTQNVQHYVLSEQKYAGKVKALDAELSAAEAGAARYVVSGDGKGKFRT
ITEAIKAVPEYNKKRVILDIRPGTYKEKLLIPFTKPFITFVGNPRSPPTIMWDDRAATHG
KDGQPMGTMLSATVAVEADYFMASSIIFKNNAPMAAPGAHGGQAVALRVFGSKVAMYNCT
IDGGQDTLYDHKGLHYFKNCLIRGSVDFIFGFGRSLYADCTIESVTKEVAVVTAQQRSKN
IAEAIDTGFSFLRCKISGIGQIYLGRAWGDSSRVVYSYTTMGKEVVPIGWDGWEVQKPEH
SGIYYGEYKCSGPGALPSKRIGWSLVLSDIQAKPFTGSHFVYGDSWILPPPKSM
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggagattattagtcctagtagtagcagcaataacaattcacctgttcttgcaacattt
cttgtggttcttgtagtgctcctagcatcatcacggccagcctcgtcgcagaaccagcaa
tccttcaccatcaaccccggcggcgccgcggcggcgaggcccggcggcggtaaaggcggc
ggcggcggcggcgggccgggcagcttcagcgacttcctgacccagaacgtgcagcactac
gtgctgagcgagcagaagtacgccgggaaggtgaaggcgctggacgcggagctgtcggca
gcggaggccggcgcggcgaggtacgtggtgagcggcgacgggaaggggaagttcaggacc
atcaccgaggccatcaaggccgtgccggagtacaacaagaagagggtcatcctcgacatc
aggcccggcacctacaaggagaagctgttgatcccgttcacgaagccgttcatcacgttc
gtggggaacccgaggagcccgccgacgatcatgtgggacgacagggcggcgacgcacggc
aaggacggccagcccatgggcaccatgctctccgccaccgtcgccgtcgaggccgactac
ttcatggcctccagcatcatcttcaagaacaacgcgccgatggcggcgccgggagcgcat
ggagggcaggcggtggcgctgcgggtgttcgggagcaaggtggcgatgtacaactgcacc
atcgacggcgggcaggacacgctgtacgaccacaagggcctccattacttcaagaactgc
ctcatccgtggcagcgtcgacttcatcttcggcttcggcaggtccctctacgcggattgc
acgattgagtcggtgacgaaggaggtggcggtggtgacggcgcagcagaggagcaagaac
attgccgaggccatcgacaccgggttctccttcctgcgctgcaagatcagcggcattggg
cagatctacctggggcgggcatggggtgactcgtcccgggtggtttactcctacaccacc
atgggcaaggaggttgtgccgatcggttgggacggctgggaagtccagaaacccgagcat
agcgggatatactacggagagtacaagtgcagtgggcccggggcgctgcctagcaagagg
atcgggtggtcgctggtgctgagcgacatccaggccaagcccttcaccggatcacacttc
gtctacggcgactcctggatcctgccgcctcccaagagcatgtaa

DBGET integrated database retrieval system