KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os12t0597000-01Help
Entry
Os12t0597000-01   CDS       T02163                                 

Gene name
Os12g0597000, CALCINEURIN_B-LIKE_PROTEIN_2, CBL2
Definition
Similar to Calcineurin B-like protein 2 (SOS3-like calcium binding protein 1).
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Protein phosphatases and associated proteins [BR:dosa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Os12t0597000-01 (Os12g0597000)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr12:join(25063696..25063816,25063948..25064030,25064168..25064227,25065302..25065410,25065626..25065678,25066172..25066252,25066860..25066972,25067693..25067750)
AA seq 225 aa AA seqDB search
MVQCLDGVRQLLAVVFKCCDLELKQPRGLEDPQVLARETVFSVSEVEALYELFKKISSAV
IDDGLINKEEFQLALFKTSKKESLFADRVFDLFDTKHNGILGFDEFARALSVFHPSAPLD
EKIDFSFQLYDLKQQGYIERQEVKQMVVATLAESGMNLSDEIIESIIDKTFEEADTKHDG
RIDKEEWRNLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagtgtctcgacggggtgaggcagctgctggcggtcgtgttcaagtgctgcgac
ctcgagctgaagcagccgcgggggctcgaggatccccaggtcctcgcgagggagaccgtc
ttcagcgtgagcgaggtcgaggcgctgtacgagctcttcaagaagataagcagtgctgtg
attgatgacgggctgattaacaaggaggagtttcagttggcgctgttcaagaccagcaag
aaggagagcctgttcgccgaccgtgtatttgatttgtttgacacaaaacacaatggaatt
ttaggatttgatgaatttgctcgtgcactctcagtatttcatccaagtgctccacttgat
gagaagattgacttttcattccagttatatgatctcaagcaacaaggctatattgagaga
caagaggttaagcagatggttgttgctacacttgctgagtctggaatgaatctttctgat
gaaattatagagagcataatcgataagacatttgaggaggcagacacaaagcatgatgga
agaattgataaagaagagtggcgcaatctggttcttcgtcatccctctttgctgaagaac
atgactctccagtacctcaaggacatcaccactacatttccaagctttgtcttccattcc
caggtcgatgacacctga

DBGET integrated database retrieval system