KEGG   Dendroctonus ponderosae (mountain pine beetle): 109537595Help
Entry
109537595         CDS       T04899                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12-like
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
dpa  Dendroctonus ponderosae (mountain pine beetle)
Brite
Enzymes [BR:dpa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     109537595
Peptidases [BR:dpa01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   109537595
Exosome [BR:dpa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   109537595
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 375 aa AA seqDB search
MGCGCSRKRSNSIQLLTGDDLSASTDKTALRRCTCRKTVARSALVLLLSLLGAFMVVWVV
IPVSFMLSLPFQTFMVFVPIDSPRNADFDRPESFGLEGVRNFHISTRDYYQNDTWTSIGA
WMLLPEDEISSSASSNVTEILQNTQKDILVYLHGVLANRAKALEQYRVLRRHFLVVAIDH
RGYGDSGRNVRMGEEGMAHDHVQIFQWIKSINPQRDVYYWGHSMGSGISARTLKLLNQQH
SISPTGLILESPFTSLEDVVSTMVLGRMFSWLAYFEAAILRPLATNGFHFRSKENIQSID
CPVMILHAEDDMIVSFSLGEALAQVAQDTREPHQGPVLFQGISADYGFGHNDIVHHPEID
DFIQNFQAICQNFTH
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgggttgtgggtgttcgcgcaagcgatccaactcaatccagctgctaacaggggatgac
ttgagcgcttccaccgataaaacggcccttcggagatgcacctgcagaaaaaccgtcgcc
cgaagtgcgttggttctgctgctgagccttctgggggccttcatggtcgtctgggtggtg
atcccagtgtctttcatgctgtcgctgcccttccagacttttatggtcttcgtcccgatc
gactccccgaggaacgcggactttgaccggccggagtccttcgggctggaaggagtgcga
aatttccacatttccactcgggattactaccagaacgacacttggaccagcattggagcc
tggatgttgctgcccgaggacgaaatcagctcctccgccagcagcaatgtgacggaaatc
ctccaaaacacccaaaaggacattctggtgtatctccacggcgtgctggccaatagagcg
aaggctctggagcagtatcgggtgctgaggaggcactttctagtggtggccatcgatcat
cgaggctacggagactccggccgcaacgtccgcatgggcgaagaaggaatggcgcacgat
catgtgcagattttccaatggatcaagtccatcaacccccagagggatgtttactattgg
ggacactcaatggggagcggcatcagcgcccgcactctaaagctgctcaaccaacagcat
tccatctccccaactggactcatcctggagtccccgttcacctccttggaggacgtggtc
tccacaatggttttagggaggatgttcagctggttggcgtactttgaggccgcaatcctg
cggcctctggccaccaacggcttccatttccgctccaaggagaacatccaatcgatagac
tgtccggtgatgattctgcatgccgaggacgacatgattgtctcgttttcactgggcgaa
gccctggctcaagtggcgcaagacacgcgcgagccccatcaaggcccagtgctcttccag
ggcatttcggcggattacggtttcggccacaacgacatcgtccaccatccggaaatcgac
gacttcatccagaacttccaggccatttgccagaacttcacccactaa

DBGET integrated database retrieval system