KEGG   Deinococcus peraridilitoris: Deipe_0042Help
Entry
Deipe_0042        CDS       T02381                                 

Definition
family 4 glycosyl hydrolase, alpha-galactosidase/6-phospho-beta-glucosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
dpd  Deinococcus peraridilitoris
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dpd00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:dpd00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
51587..52966
Genome map
AA seq 459 aa AA seqDB search
MRAESASSKVTRIVITGAGGMTFPLTLIADLLTMPELQGAEVVLHDLSLERAARTARAAQ
AVADAHARPLQLVVTTDRREALRGATHLLLTFQVGGLAAYRSDTEIPRRYGVDCVAGDTL
GPGGIMRFVRSAPAFEDLARDVLELCPEALVLNYTNPMAMNCLYLQHLGLRVVGLCHSVP
TSARVIEELLGLDAGKLRYVAAGINHQAWFLTVEAAGKDLRDDLRDVLRARFLPEYGGTT
PWTEGDLAYQGGQERVRAELLETFGYFLSESSHHASEYVPFFRRSPESVKAHLPRRWDYL
RGSLNVAGQEDALVSATVARLRARLECSGEFGMRVIAALVGGPAANVYVNVRNDGWIANL
PGDACVEVSALVNEAGVHPTVVGRLPGGCAGLNLTGIALQTAAVEAVIRRDCAALIGAFA
LDPLTASLVELPAIRRLASELLAAQATWLPSWLRTQARL
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgctgaatcggcgagcagcaaggtgacacgcatcgtcatcactggcgcgggcggc
atgaccttcccgctcacgctcatcgccgacctgctcaccatgcccgaattgcagggcgca
gaagtagtcctgcacgacctcagcctggaacgggccgccaggaccgcgcgcgccgctcaa
gccgttgcagacgctcacgcgcgacccttgcagctggtcgtcacgaccgaccggcgcgaa
gcgctgcggggcgcgacgcacctgctgctcacctttcaggtcggcgggctcgctgcctac
cgctcggacaccgagattccgcgccgctacggcgtcgactgtgttgccggggataccctg
ggccccggcgggatcatgcgcttcgtgcgcagcgcgcccgccttcgaggacctggcgcgt
gacgtgctcgagctgtgccctgaggcgctggtgctgaactacaccaaccccatggcgatg
aactgcctttacctgcagcatctggggctccgggtcgtggggttgtgccacagcgtcccc
acttccgctcgggtgatcgaggaactgcttgggctggatgcgggaaaactccggtacgtc
gcagcgggcatcaatcaccaggcctggtttctgacggtggaggcggcagggaaggatctc
cgtgatgacctgcgtgacgtgctgcgggcgcgcttcctgcccgagtatgggggcacgaca
ccatggacggaaggggacctcgcctaccagggagggcaggagcgcgtccgggcggagctg
ctggagaccttcgggtactttttgagcgagtcgagtcatcacgcctcggagtacgtgccg
ttcttccggcgctctccagaaagcgtcaaggcgcatctgcctcgccgctgggattacctg
cgcggctcgctgaacgtcgccgggcaggaggacgctctggtcagcgccacggtggcacgg
ctgcgcgcacgactggaatgctcaggcgagttcggcatgcgcgtcatcgccgcgctggtg
ggcggcccggcggcgaatgtttatgtgaacgtgcgcaacgacggctggatcgccaacctg
ccgggggacgcctgcgtggaggtgtccgcgctggtgaacgaggccggcgtgcacccgacg
gtggtgggccgcctgccgggcgggtgtgccggcctgaacctgacagggatcgccttgcag
actgccgcggtcgaagcggtcatcaggcgcgactgcgccgcgctgatcggcgccttcgcg
ctcgatccgctcacggcaagtctggtggaactgcccgccatccggcgcctggccagtgag
ctgctggcggcgcaggcaacgtggctgccctcgtggttgcgcacccaagcccgcttgtga

DBGET integrated database retrieval system