KEGG   Deinococcus peraridilitoris: Deipe_0120Help
Entry
Deipe_0120        CDS       T02381                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
dpd  Deinococcus peraridilitoris
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:dpd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Deipe_0120
  Amino acid metabolism
   00340 Histidine metabolism
    Deipe_0120
Enzymes [BR:dpd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Deipe_0120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
153510..154865
Genome map
AA seq 451 aa AA seqDB search
MLGKCFRIVGVNILTGDAARAALKRTFADNPVPESVLQRSAALFGERLSPQQAVDRILAD
VRERGDAALRHWTQLIDGVDIDVVQLPAHLIESARVEPDLHEAILVAIARVRAFHEKQPA
GGWIEHTEGGALGQLVRPLERLGVYVPGGLAPLVSSLIHTAVPAVVAGVREIVVATPPGQ
GGQVHPAILVAAREIGVEAVYRVGGAQAIAALAYGTESIAAVDKIAGPGNQFVVLAKRAV
YGSVGIESLPGPTETLVLADDGADARFVAADLLAQAEHNGAEPVLVTDSRELLIEVEREL
ARQLENLPEPNRSWARDSVMTRFKIVLAGDLDEAFELANLYAPEHLCLLLQDAWSYVGKV
RRAGGIFVGEASMEALGDYAAGPSHVMPTGGTARFLSPVNVRDFQNIISLIGLNEVTLRE
VGPHAARLARAEGLEAHARAIEIRLQDGKAH
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
gtgctcggcaaatgctttaggatcgtgggcgtgaatatcctgaccggtgacgcggcgcgt
gccgccctcaagcgcacctttgccgacaatcccgttcccgaaagcgtgctgcagcgcagc
gccgccctgttcggcgagcggctttctccgcagcaggccgtcgaccgcattcttgcggac
gtccgcgagcgtggcgacgcggcgctgcgtcactggacccagctgatcgacggagttgac
atcgacgtggtgcagcttcccgcacacctgatcgaatcggccagggtcgagcctgacctt
cacgaggccattctggtcgccatcgctcgggtgcgtgcctttcacgagaaacaacctgcc
ggtggctggatcgagcacaccgagggcggcgcgctgggccagctggtccggccgctggag
cgcctgggcgtgtacgtgccagggggtctggcgccgctggtgagcagcctgatccacacg
gccgtgccggccgtggtggcaggcgtccgcgagattgtggtggccaccccgcccggacag
ggcggacaggtgcacccggcgattctggtggccgcccgtgaaatcggcgtggaagcggtg
taccgggttggcggcgcccaggccattgcggcgctggcatacggcaccgaaagcatcgcg
gcagtggacaagatcgccggaccgggcaaccagttcgtggtgctcgccaaacgggccgtt
tacggtagtgtgggcatcgaaagcctgcccggtccgaccgagacgctggtcctggccgac
gacggcgccgacgcgcgcttcgtggcggcagatctgctggcgcaggccgagcacaacggc
gccgaacccgtgctggtcaccgactcgcgggagctgttgatcgaggtggagcgcgagctc
gcgagacaactcgaaaaccttcccgaaccaaaccgcagctgggcgcgtgactcggtgatg
acgcgcttcaagatcgtgctggcaggtgacctcgatgaagccttcgagctggcgaacctg
tatgcgcccgaacatctgtgcctgctgctgcaggacgcctggtcatacgtcggtaaagtc
cggcgtgccggcggcatctttgtcggtgaggccagcatggaagcgctgggcgactacgcg
gccggacccagccacgtgatgcccactggcggcaccgcccgttttctgagtccggtcaac
gtgcgcgactttcagaacatcatctccctcatcggtctgaacgaagtgacgctacgcgaa
gtcgggccacacgccgcgcgcctggcacgggccgaaggtctcgaggcacatgcccgcgcc
atcgagatccgcctgcaagacgggaaagcgcattga

DBGET integrated database retrieval system