KEGG   Deinococcus peraridilitoris: Deipe_0151Help
Entry
Deipe_0151        CDS       T02381                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
dpd  Deinococcus peraridilitoris
Pathway
dpd00620  Pyruvate metabolism
dpd00630  Glyoxylate and dicarboxylate metabolism
dpd01100  Metabolic pathways
dpd01110  Biosynthesis of secondary metabolites
dpd01120  Microbial metabolism in diverse environments
dpd01200  Carbon metabolism
Module
dpd_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:dpd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Deipe_0151
   00630 Glyoxylate and dicarboxylate metabolism
    Deipe_0151
Enzymes [BR:dpd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Deipe_0151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: AFZ65755
UniProt: K9ZYC2
Position
complement(187415..188809)
Genome map
AA seq 464 aa AA seqDB search
MTPGLLEDQLDSKSLGLYAALHREFYGIWRALSTVEDSEARSLNLPEDWQLPPVPDELRG
RTVELVVTAGDDATLREGLVLNVDAVMLDFDDTFSPTRAGVLRAYAHLRDLSHLEGTPLM
LRPRPHYLPEFSFRFTGETVIASLLDLSVFLAHHRHRSPLYLYLPKLERPAEARFWNQVL
RRAEELLSLPSGTVRPCLQIETWSGAQLAEEMLFELRERAYGLNAGRWDYVFSLVKHLGQ
EAGPVLPERARLGMDQPCMQAYARLLPSVCVRRGGRAVGGSAALAPDPQDPQAALSAVTQ
DKRREVAYGYQAAWAGLPSLIPAVREAFSREPPQARGAQGAGPEELSAFPPVTSVPLAAV
REALGIALDYFAAWHAGLGVIVREGRIEDTATAELARAQLWQWVHHRVRLTEGGTLSPQR
YRELREEHAQEKSFAGELLDTLVLADTCADYFPLVAARLRGWEI
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgacgcctggccttctcgaagaccagctggattcgaagtcgctcgggttgtacgcggcc
ctgcaccgcgagttttatggtatctggcgtgcactctccacggtggaggactccgaagcc
cgctccctgaacctgcccgaggactggcagctgccccccgtccccgatgaactgcgaggc
cgcacggtcgagctggtggtgaccgccggagatgacgcgacgctgcgtgaagggctggtc
ctgaacgtggacgccgtcatgctggattttgacgataccttctcgcccacacgcgcaggt
gttctccgcgcctacgcgcatctgcgcgacctgagtcatctggaaggaacgccgttgatg
ttgcgtccccggccgcattatctgccggagttctcgtttcgcttcacgggtgaaacagtg
atcgcctcgttgctggatctgtcggtattcctggcacaccaccgtcaccgttcgcccctt
tacctgtacctgcccaagctggaacgcccggcagaggcgcgcttttggaaccaggtgctc
aggcgcgccgaggagctgctgtcacttccttcgggtaccgtccggccctgtctgcaaatc
gagacctggtcgggggcgcagcttgccgaagagatgctcttcgaattgcgcgaacgtgcg
tatggcctgaacgccggacgctgggattatgtgttcagcctcgtgaagcatctcgggcag
gaggcgggtccggtgctgcccgagcgggcgcgtctgggcatggatcagccctgtatgcag
gcctacgcgcgtctgctgcccagcgtgtgcgtgcggcgtggcggtcgggcggtgggcgga
agcgccgcccttgctcccgatccgcaagatcctcaggccgccctgagtgccgtgacacag
gacaagcggcgtgaagtggcgtacggctaccaggcggcctgggctggcctgcccagcctg
attcccgcagtccgtgaagccttctcacgggaaccgccgcaggctcgcggcgctcagggc
gccggacctgaggagttgagcgccttcccaccggtcacatcggtgccgctggccgccgtg
cgtgaagccctgggcatcgcgctcgattactttgccgcgtggcacgccgggctgggcgtg
atcgtgcgtgaagggcgcatcgaggatacggctaccgcggaactcgctcgtgcccagctg
tggcagtgggtgcaccatcgggtgcgcctcacagagggcggaaccctgtctccccagcgc
taccgcgagctgcgtgaagagcacgcgcaggagaagtcgtttgccggggagctgcttgac
accctggtcctggcggacacgtgcgcggattatttcccgctggtcgccgccaggctgcga
ggatgggaaatatga

DBGET integrated database retrieval system