KEGG   Deinococcus peraridilitoris: Deipe_0154Help
Entry
Deipe_0154        CDS       T02381                                 

Definition
malate synthase A
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
dpd  Deinococcus peraridilitoris
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:dpd01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dpd00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:dpd00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
190266..191834
Genome map
AA seq 522 aa AA seqDB search
MTDRLPLDVPGLTLTRPPSSEATSLLTTEAMQFVADLHRRFDARRQELLAAREARQQRLD
AGERPDFLPETADVRAGDWQVSPPMPDLTDRRVEITGPVDRKMIINALNSGAKVFMADFE
DASTPTWENVVAGQQNLYDAVRRTISLDQGGKQYRLQDEVATLIVRPRGWHLPEKHVLID
GEEVSGAIFDFGLYFFHNAAERLSQGKGTYFYLPKLESHLEARLWNDIFNFAEDALQLPR
GTIRATVLIETILAAFEMDEILYELREHSAGLNCGRWDYIFSVIKKLRADPRFVLPDRAR
ITMETHLMRSYSRLAIQTCHRRGAHAMGGMSAFIPVKNDEAANDRAFAQVRADKEREASD
GHDGTWVAHPALVPVAREVFDRLMPTPNQLHVIPEVRITAADLLQVPEGPITEAGVRLNI
SVALQYLDAWLRGSGAVPINNLMEDAATAEISRAQIWQWQRHRARLDDGREIDPELVRRL
FEEELATLGRERYADAATLLYDLATREPLVDFLTLPGYRQLA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccgccttccccttgatgttcccggcctgaccctgacccgtccgccgtcctcg
gaggcgaccagcctgctgacaaccgaggcgatgcaattcgtcgccgatctgcaccgccgg
ttcgacgcgcgtcgccaggagctgcttgccgcgcgcgaagcccgtcagcagcgactcgac
gcgggcgagcgtcccgatttcctgcccgaaacggccgatgtgcgcgcgggcgactggcag
gtgtcgccgcccatgcctgatctgaccgaccggcgggtcgagatcaccggtccagtggac
cgcaagatgatcatcaacgcacttaacagcggcgcgaaggtgttcatggccgacttcgag
gatgccagtactcccacttgggaaaacgtggtagccggtcagcagaatctctatgacgcg
gtgcgccggaccatcagcctcgatcagggcggtaaacagtaccgcctgcaagatgaggtg
gctacgctgatcgttcgcccgcgtggctggcacctgccagaaaagcacgtgctgatcgat
ggcgaggaagtctccggggcgatcttcgacttcgggctgtacttctttcacaacgccgcc
gagcgcctttcgcaggggaaaggaacctacttttacctgcccaagctcgaaagccacctg
gaagcgcgcttgtggaatgacatcttcaattttgccgaagacgccctgcagcttccccgt
ggcaccatccgcgccaccgtgctgatcgaaacgatcctggccgccttcgagatggacgaa
attctctacgagctgcgcgagcattccgccggactcaactgcggtcgctgggactacatc
ttcagcgtcatcaagaagctgcgcgccgacccccgcttcgtgctgcccgaccgggcgcgc
atcacgatggaaacgcacctgatgcgctcgtactcacgtctggccatccagacctgccac
aggcgaggggcccacgcgatgggcggcatgagcgccttcattccggtcaagaacgacgag
gccgccaacgaccgcgccttcgcgcaggtgcgcgccgacaaggaacgcgaagcgagcgac
gggcacgacggcacctgggttgcccaccccgccctggtgcccgtggcgcgtgaggtcttt
gaccggctgatgcccactcccaaccagctgcacgtgattccggaggtccggatcacggct
gcggacctcctgcaggtgcccgagggacccattaccgaggcaggagtacgcctgaacatc
agcgtggcattgcagtacctcgacgcctggctgcgcggcagtggtgccgtgcccatcaac
aacctgatggaagacgccgccaccgccgagatttcacgcgcgcagatctggcagtggcag
cgtcaccgggcacggctcgacgatgggcgcgaaatcgacccggagctggtgcgccggctg
ttcgaagaagagctcgccacgctgggacgtgaacgctacgccgatgcggccaccctgctc
tatgacctcgccacacgtgaaccgctggtggacttcctgacgttgcccggctaccgccag
ctggcatga

DBGET integrated database retrieval system