KEGG   Deinococcus peraridilitoris: Deipe_0154Help
Entry
Deipe_0154        CDS       T02381                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
dpd  Deinococcus peraridilitoris
Pathway
dpd00620  Pyruvate metabolism
dpd00630  Glyoxylate and dicarboxylate metabolism
dpd01100  Metabolic pathways
dpd01110  Biosynthesis of secondary metabolites
dpd01120  Microbial metabolism in diverse environments
dpd01200  Carbon metabolism
Module
dpd_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:dpd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Deipe_0154
   00630 Glyoxylate and dicarboxylate metabolism
    Deipe_0154
Enzymes [BR:dpd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Deipe_0154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: AFZ65758
UniProt: K9ZVV8
Position
190266..191834
Genome map
AA seq 522 aa AA seqDB search
MTDRLPLDVPGLTLTRPPSSEATSLLTTEAMQFVADLHRRFDARRQELLAAREARQQRLD
AGERPDFLPETADVRAGDWQVSPPMPDLTDRRVEITGPVDRKMIINALNSGAKVFMADFE
DASTPTWENVVAGQQNLYDAVRRTISLDQGGKQYRLQDEVATLIVRPRGWHLPEKHVLID
GEEVSGAIFDFGLYFFHNAAERLSQGKGTYFYLPKLESHLEARLWNDIFNFAEDALQLPR
GTIRATVLIETILAAFEMDEILYELREHSAGLNCGRWDYIFSVIKKLRADPRFVLPDRAR
ITMETHLMRSYSRLAIQTCHRRGAHAMGGMSAFIPVKNDEAANDRAFAQVRADKEREASD
GHDGTWVAHPALVPVAREVFDRLMPTPNQLHVIPEVRITAADLLQVPEGPITEAGVRLNI
SVALQYLDAWLRGSGAVPINNLMEDAATAEISRAQIWQWQRHRARLDDGREIDPELVRRL
FEEELATLGRERYADAATLLYDLATREPLVDFLTLPGYRQLA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccgccttccccttgatgttcccggcctgaccctgacccgtccgccgtcctcg
gaggcgaccagcctgctgacaaccgaggcgatgcaattcgtcgccgatctgcaccgccgg
ttcgacgcgcgtcgccaggagctgcttgccgcgcgcgaagcccgtcagcagcgactcgac
gcgggcgagcgtcccgatttcctgcccgaaacggccgatgtgcgcgcgggcgactggcag
gtgtcgccgcccatgcctgatctgaccgaccggcgggtcgagatcaccggtccagtggac
cgcaagatgatcatcaacgcacttaacagcggcgcgaaggtgttcatggccgacttcgag
gatgccagtactcccacttgggaaaacgtggtagccggtcagcagaatctctatgacgcg
gtgcgccggaccatcagcctcgatcagggcggtaaacagtaccgcctgcaagatgaggtg
gctacgctgatcgttcgcccgcgtggctggcacctgccagaaaagcacgtgctgatcgat
ggcgaggaagtctccggggcgatcttcgacttcgggctgtacttctttcacaacgccgcc
gagcgcctttcgcaggggaaaggaacctacttttacctgcccaagctcgaaagccacctg
gaagcgcgcttgtggaatgacatcttcaattttgccgaagacgccctgcagcttccccgt
ggcaccatccgcgccaccgtgctgatcgaaacgatcctggccgccttcgagatggacgaa
attctctacgagctgcgcgagcattccgccggactcaactgcggtcgctgggactacatc
ttcagcgtcatcaagaagctgcgcgccgacccccgcttcgtgctgcccgaccgggcgcgc
atcacgatggaaacgcacctgatgcgctcgtactcacgtctggccatccagacctgccac
aggcgaggggcccacgcgatgggcggcatgagcgccttcattccggtcaagaacgacgag
gccgccaacgaccgcgccttcgcgcaggtgcgcgccgacaaggaacgcgaagcgagcgac
gggcacgacggcacctgggttgcccaccccgccctggtgcccgtggcgcgtgaggtcttt
gaccggctgatgcccactcccaaccagctgcacgtgattccggaggtccggatcacggct
gcggacctcctgcaggtgcccgagggacccattaccgaggcaggagtacgcctgaacatc
agcgtggcattgcagtacctcgacgcctggctgcgcggcagtggtgccgtgcccatcaac
aacctgatggaagacgccgccaccgccgagatttcacgcgcgcagatctggcagtggcag
cgtcaccgggcacggctcgacgatgggcgcgaaatcgacccggagctggtgcgccggctg
ttcgaagaagagctcgccacgctgggacgtgaacgctacgccgatgcggccaccctgctc
tatgacctcgccacacgtgaaccgctggtggacttcctgacgttgcccggctaccgccag
ctggcatga

DBGET integrated database retrieval system