KEGG   Deinococcus peraridilitoris: Deipe_0154Help
Entry
Deipe_0154        CDS       T02381                                 

Definition
(RefSeq) malate synthase A
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
dpd  Deinococcus peraridilitoris
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:dpd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Deipe_0154
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Deipe_0154
   00630 Glyoxylate and dicarboxylate metabolism
    Deipe_0154
Enzymes [BR:dpd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Deipe_0154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
190266..191834
Genome map
AA seq 522 aa AA seqDB search
MTDRLPLDVPGLTLTRPPSSEATSLLTTEAMQFVADLHRRFDARRQELLAAREARQQRLD
AGERPDFLPETADVRAGDWQVSPPMPDLTDRRVEITGPVDRKMIINALNSGAKVFMADFE
DASTPTWENVVAGQQNLYDAVRRTISLDQGGKQYRLQDEVATLIVRPRGWHLPEKHVLID
GEEVSGAIFDFGLYFFHNAAERLSQGKGTYFYLPKLESHLEARLWNDIFNFAEDALQLPR
GTIRATVLIETILAAFEMDEILYELREHSAGLNCGRWDYIFSVIKKLRADPRFVLPDRAR
ITMETHLMRSYSRLAIQTCHRRGAHAMGGMSAFIPVKNDEAANDRAFAQVRADKEREASD
GHDGTWVAHPALVPVAREVFDRLMPTPNQLHVIPEVRITAADLLQVPEGPITEAGVRLNI
SVALQYLDAWLRGSGAVPINNLMEDAATAEISRAQIWQWQRHRARLDDGREIDPELVRRL
FEEELATLGRERYADAATLLYDLATREPLVDFLTLPGYRQLA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccgccttccccttgatgttcccggcctgaccctgacccgtccgccgtcctcg
gaggcgaccagcctgctgacaaccgaggcgatgcaattcgtcgccgatctgcaccgccgg
ttcgacgcgcgtcgccaggagctgcttgccgcgcgcgaagcccgtcagcagcgactcgac
gcgggcgagcgtcccgatttcctgcccgaaacggccgatgtgcgcgcgggcgactggcag
gtgtcgccgcccatgcctgatctgaccgaccggcgggtcgagatcaccggtccagtggac
cgcaagatgatcatcaacgcacttaacagcggcgcgaaggtgttcatggccgacttcgag
gatgccagtactcccacttgggaaaacgtggtagccggtcagcagaatctctatgacgcg
gtgcgccggaccatcagcctcgatcagggcggtaaacagtaccgcctgcaagatgaggtg
gctacgctgatcgttcgcccgcgtggctggcacctgccagaaaagcacgtgctgatcgat
ggcgaggaagtctccggggcgatcttcgacttcgggctgtacttctttcacaacgccgcc
gagcgcctttcgcaggggaaaggaacctacttttacctgcccaagctcgaaagccacctg
gaagcgcgcttgtggaatgacatcttcaattttgccgaagacgccctgcagcttccccgt
ggcaccatccgcgccaccgtgctgatcgaaacgatcctggccgccttcgagatggacgaa
attctctacgagctgcgcgagcattccgccggactcaactgcggtcgctgggactacatc
ttcagcgtcatcaagaagctgcgcgccgacccccgcttcgtgctgcccgaccgggcgcgc
atcacgatggaaacgcacctgatgcgctcgtactcacgtctggccatccagacctgccac
aggcgaggggcccacgcgatgggcggcatgagcgccttcattccggtcaagaacgacgag
gccgccaacgaccgcgccttcgcgcaggtgcgcgccgacaaggaacgcgaagcgagcgac
gggcacgacggcacctgggttgcccaccccgccctggtgcccgtggcgcgtgaggtcttt
gaccggctgatgcccactcccaaccagctgcacgtgattccggaggtccggatcacggct
gcggacctcctgcaggtgcccgagggacccattaccgaggcaggagtacgcctgaacatc
agcgtggcattgcagtacctcgacgcctggctgcgcggcagtggtgccgtgcccatcaac
aacctgatggaagacgccgccaccgccgagatttcacgcgcgcagatctggcagtggcag
cgtcaccgggcacggctcgacgatgggcgcgaaatcgacccggagctggtgcgccggctg
ttcgaagaagagctcgccacgctgggacgtgaacgctacgccgatgcggccaccctgctc
tatgacctcgccacacgtgaaccgctggtggacttcctgacgttgcccggctaccgccag
ctggcatga

DBGET integrated database retrieval system