KEGG   Deinococcus peraridilitoris: Deipe_0914Help
Entry
Deipe_0914        CDS       T02381                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dpd  Deinococcus peraridilitoris
Pathway
dpd00020  Citrate cycle (TCA cycle)
dpd00310  Lysine degradation
dpd01100  Metabolic pathways
dpd01110  Biosynthesis of secondary metabolites
dpd01120  Microbial metabolism in diverse environments
dpd01130  Biosynthesis of antibiotics
dpd01200  Carbon metabolism
Module
dpd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dpd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dpd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Deipe_0914
  Amino acid metabolism
   00310 Lysine degradation
    Deipe_0914
Enzymes [BR:dpd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Deipe_0914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 PYNP_C
Motif
Other DBs
NCBI-ProteinID: AFZ66483
UniProt: K9ZXU2
Position
938231..939511
Genome map
AA seq 426 aa AA seqDB search
MADIKVPVFSESISEGTLLSWHKKPGDTVKRGEVVAEIETDKVVLEVTALQDGVLQSVAR
NEGDTVLSEEVLGTIGEGGAASSPAASAPAPQANVQTPSAAAAVAEKPAVATDDLSPAVR
KLVIEGGLDPAQLQGTGKDGRITKGDVLAHGQAGPSATAPAQSVPAAGTQTVSAPLPGGA
RPEHEVPRREHEVPRREQRVPMTRIRARIAERLKEVQNTAAILTTFNEVNMKPAMDLRKK
YQDAFVAKHGVKLGFMSLFVRAATEALKQFPVVNASLEGKDVIYHGYYDIGIAVASERGL
VVPILRDTDSMSLAGIEKQIADFAGKARNGKLTLEDMTGGTFSITNGGTFGSMMSTPILN
QPQSAILGMHNIIERPIVENGQIVARPMMYLALSYDHRIIDGREAVLFLVTIKNILEDPA
RLLLDL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggcggacatcaaggtacccgtattcagcgaatcgatcagtgaaggcaccctgctgagc
tggcacaagaaacccggagacacggtcaagcgcggcgaggtcgtggccgaaatcgaaacc
gacaaggtcgtgctggaagtcacggccctgcaggacggcgtgctacagagtgtcgccagg
aacgaaggagacacagtcctcagcgaggaagttctgggcaccatcggtgagggcggagcg
gcgtccagcccggctgccagtgcccccgctccgcaggcgaacgtgcagacgcccagtgcg
gctgcagcggtcgccgagaaaccggccgtggccacagacgacctctcccccgccgtacgc
aagctcgtgatcgagggcggcctcgaccccgcgcagttgcagggtaccggcaaggacggc
cgcatcaccaagggcgacgtcctggcccacggtcaggctggcccgagcgcgacggcgccc
gcgcaaagcgtcccggcggcaggcacccagacggtcagcgcgcccctgccgggcggcgcg
cgacctgagcacgaagtaccccgcagggagcacgaagtaccccgcagggagcagcgcgtg
cccatgacccgcatccgcgcccgcatcgccgagcgcctcaaggaagtccagaacaccgcc
gccatcctgacgaccttcaacgaggtcaacatgaagccggccatggacctgcgcaagaag
taccaggacgcctttgtcgccaagcacggcgtcaagctcggcttcatgagcctcttcgtg
cgcgccgccaccgaggccctcaagcagttcccggtcgtgaacgccagcctggaaggcaag
gatgttatctaccacggctactacgacatcggcatcgcggtcgcgagcgagcgcggtctg
gtggtgcccatcctgcgcgacaccgacagcatgagccttgcgggcatcgagaaacagatc
gccgacttcgcgggcaaggcgagaaacggcaagcttaccctggaggacatgacgggcggc
accttcagcatcaccaatgggggcaccttcggttccatgatgagcacgcccatcctcaac
cagccgcagagcgccattctgggcatgcacaacatcatcgagcggcccattgtcgaaaac
ggccagatcgtggcgcgcccgatgatgtacctggcgctcagctacgatcaccgcatcatc
gacggccgtgaggcggtgctgttcctggtgaccatcaagaacatcctcgaagaccccgcc
cgcctgctgctcgacctgtaa

DBGET integrated database retrieval system