KEGG   Deinococcus peraridilitoris: Deipe_0914Help
Entry
Deipe_0914        CDS       T02381                                 

Definition
2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dpd  Deinococcus peraridilitoris
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dpd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Deipe_0914
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Deipe_0914
  Amino acid metabolism
   00310 Lysine degradation
    Deipe_0914
Enzymes [BR:dpd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Deipe_0914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
938231..939511
Genome map
AA seq 426 aa AA seqDB search
MADIKVPVFSESISEGTLLSWHKKPGDTVKRGEVVAEIETDKVVLEVTALQDGVLQSVAR
NEGDTVLSEEVLGTIGEGGAASSPAASAPAPQANVQTPSAAAAVAEKPAVATDDLSPAVR
KLVIEGGLDPAQLQGTGKDGRITKGDVLAHGQAGPSATAPAQSVPAAGTQTVSAPLPGGA
RPEHEVPRREHEVPRREQRVPMTRIRARIAERLKEVQNTAAILTTFNEVNMKPAMDLRKK
YQDAFVAKHGVKLGFMSLFVRAATEALKQFPVVNASLEGKDVIYHGYYDIGIAVASERGL
VVPILRDTDSMSLAGIEKQIADFAGKARNGKLTLEDMTGGTFSITNGGTFGSMMSTPILN
QPQSAILGMHNIIERPIVENGQIVARPMMYLALSYDHRIIDGREAVLFLVTIKNILEDPA
RLLLDL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggcggacatcaaggtacccgtattcagcgaatcgatcagtgaaggcaccctgctgagc
tggcacaagaaacccggagacacggtcaagcgcggcgaggtcgtggccgaaatcgaaacc
gacaaggtcgtgctggaagtcacggccctgcaggacggcgtgctacagagtgtcgccagg
aacgaaggagacacagtcctcagcgaggaagttctgggcaccatcggtgagggcggagcg
gcgtccagcccggctgccagtgcccccgctccgcaggcgaacgtgcagacgcccagtgcg
gctgcagcggtcgccgagaaaccggccgtggccacagacgacctctcccccgccgtacgc
aagctcgtgatcgagggcggcctcgaccccgcgcagttgcagggtaccggcaaggacggc
cgcatcaccaagggcgacgtcctggcccacggtcaggctggcccgagcgcgacggcgccc
gcgcaaagcgtcccggcggcaggcacccagacggtcagcgcgcccctgccgggcggcgcg
cgacctgagcacgaagtaccccgcagggagcacgaagtaccccgcagggagcagcgcgtg
cccatgacccgcatccgcgcccgcatcgccgagcgcctcaaggaagtccagaacaccgcc
gccatcctgacgaccttcaacgaggtcaacatgaagccggccatggacctgcgcaagaag
taccaggacgcctttgtcgccaagcacggcgtcaagctcggcttcatgagcctcttcgtg
cgcgccgccaccgaggccctcaagcagttcccggtcgtgaacgccagcctggaaggcaag
gatgttatctaccacggctactacgacatcggcatcgcggtcgcgagcgagcgcggtctg
gtggtgcccatcctgcgcgacaccgacagcatgagccttgcgggcatcgagaaacagatc
gccgacttcgcgggcaaggcgagaaacggcaagcttaccctggaggacatgacgggcggc
accttcagcatcaccaatgggggcaccttcggttccatgatgagcacgcccatcctcaac
cagccgcagagcgccattctgggcatgcacaacatcatcgagcggcccattgtcgaaaac
ggccagatcgtggcgcgcccgatgatgtacctggcgctcagctacgatcaccgcatcatc
gacggccgtgaggcggtgctgttcctggtgaccatcaagaacatcctcgaagaccccgcc
cgcctgctgctcgacctgtaa

DBGET integrated database retrieval system