KEGG   Deinococcus peraridilitoris: Deipe_0964Help
Entry
Deipe_0964        CDS       T02381                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
dpd  Deinococcus peraridilitoris
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dpd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Deipe_0964
DNA repair and recombination proteins [BR:dpd03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Deipe_0964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
991075..991689
Genome map
AA seq 204 aa AA seqDB search
MKYPASLVALIRELSRLPGIGPKSAQRLAFHLFEQPREDIERLAGALLEAKRELQMCKQC
FNVTDRELCDVCTDTGRDRAQICVVEEPGDVIAIERSGEFRGLYHVLHGAISPMNGVSPE
KLYIKPLLTRLQQNELKPEDHEVILATSTTVEGEATSLYLQRLLEPLGVMVSRIAYGLPV
GGALEYADEVTLGRALAGRQRVTR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacccggccagcctggtggccttgattcgggagctgtcgcgcttgccgggcatc
ggtcccaaatcagcgcagcgcctggcctttcacctgttcgaacagccacgcgaagacatc
gagcgtctcgcgggcgccttgctggaagccaaacgcgagctgcagatgtgcaagcagtgc
ttcaacgtgaccgaccgcgaactgtgcgacgtctgcaccgacacgggacgcgatcgcgcg
cagatctgtgtggtcgaggagcccggtgacgtcatcgccatcgaacgcagtggtgagttt
cgtggcctctatcacgtcttgcacggcgcgatcagccccatgaacggcgtttctcccgag
aagctctacatcaagcctctgctgacccgactgcagcagaacgaactgaagcccgaagac
cacgaggtcatcctggccaccagcaccacggtggagggtgaagccaccagcctgtacctg
cagcgtctgctcgagccgctgggcgtcatggtgtcacgcatcgcctacggtctgcccgtg
gggggcgccctggaatacgccgacgaggtcaccctggggcgcgccctggctggccggcag
cgggtgacccgatag

DBGET integrated database retrieval system