KEGG   Deinococcus peraridilitoris: Deipe_1109Help
Entry
Deipe_1109        CDS       T02381                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
dpd  Deinococcus peraridilitoris
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dpd01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:dpd00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1126904..1127788
Genome map
AA seq 294 aa AA seqDB search
MDIALLGIPMDLGAGRRGVDMGPSALRNARLSRTLRDIGHRVSDLGDVPVPLPETRDKHE
ESGLIFLEPILQACTAAGQQLAMLGEEVFPISMGGDHSISVGTVTGAARSQRSGLIWVDA
HTDFNTPASSPSGNIHGMPVAHLVGLGDAQLNSIGGGWHMRPEDIVMIGIRSVDRRERDL
VREQGITVYTMKEVDQLGISRIAEETLERLGSLPRLHVSFDADALDPSLAPGVGTPVPGG
LTYREAHLLMELLSESGRVTSMDIVEVNPALDHQNQTAHVMVGMAASLLGKRIL
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgctcttctcggcattcccatggacctcggcgccggtcggcgcggggtggac
atgggtcccagcgccctgcgcaacgcccggctttcccgcacgctgcgcgacatcggtcat
cgcgtcagcgacctgggcgacgttccggtacccttgcccgaaacgagggacaagcacgag
gaaagcggcctgatctttctggagccgattctgcaggcctgcaccgcggcagggcagcaa
ctcgccatgcttggagaagaagtctttcccatcagcatgggtggcgaccactcgatcagc
gtgggtacggtcaccggcgcggcacgcagccagcgcagcggcctgatctgggtcgacgcc
cacactgacttcaacacgcccgcctccagccccagcggcaacattcatggcatgcccgtg
gcgcacctcgtgggcctgggagatgcccagctcaacagcatcggtggaggctggcacatg
cggcccgaggacatcgtgatgatcggcattcgcagcgtggaccgccgtgaacgcgacctg
gtgcgtgagcagggcatcacggtctacaccatgaaagaagtcgatcagctgggcataagc
cgcatcgccgaggaaacgctggagcgcctcgggtccctcccccgcctgcacgtgtccttt
gacgccgacgccctcgatcccagcctggcgcccggcgtcggcacacctgtccctggcggg
ctgacctaccgcgaagcgcacctgctgatggaactgctctcagagagcggacgtgtcacc
tcaatggacatcgtcgaggtgaacccggcgcttgaccaccagaatcagacggcgcacgtc
atggtcggcatggcggccagcttgctggggaaacgcattctgtaa

DBGET integrated database retrieval system