KEGG   Deinococcus peraridilitoris: Deipe_1237Help
Entry
Deipe_1237        CDS       T02381                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
dpd  Deinococcus peraridilitoris
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:dpd00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dpd00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1254962..1256152)
Genome map
AA seq 396 aa AA seqDB search
MYQPQPSDKFTFGLWTVGATGRDPFGEPTRPPLSAPYIVEKLAQLGAYGVNLHDNDLVPI
DAGAGERDRIVREFQQTLGDHGLVVPMATTNLFTDPAFKDGAFTSADARVRAYALQKTMR
SMDLGHELGAQTYVFWGGREGTEVDASGKLLDSIGWFRDSLNFLAEYSQSQGYGYRFALE
PKPNEPRGDIFFPTAGSMLGFIATLDQSELFGVNPEFAHDTMAGLNFTHAVAQIIDAGKL
FHVDLNDQKMGRFDQDLRFGAENIKSAFFLVKLLEDSGYDGPRHFDAHALRTEDEVGVWA
FARGCMRTYLILKDKARQFDEDPEIQAALQAYRVEDKELSELTRGFTPEKARTLKERAFD
RVALGQRGPGLEQLDQLTVELLLGVRGNSVSSEAHA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtaccagccccaaccgtcggataaattcacttttggcctctggaccgtgggcgccacc
ggacgcgacccgttcggcgaacccacccgcccgcccctcagcgcgccctacatcgtagaa
aagctcgcgcagctcggcgcctacggcgtgaatctgcacgacaacgacctggtgcccatc
gacgcgggcgcgggcgagcgcgaccgcatcgtccgcgagtttcaacagaccctgggtgac
catggcctcgtggtgcccatggccaccaccaacctgttcaccgatccggccttcaaggac
ggtgcctttaccagtgccgacgcccgcgtgcgcgcctacgcgttgcaaaagaccatgcgc
agcatggacctcggacatgaactgggcgcccagacctatgtcttctggggtgggcgcgaa
ggcaccgaggtcgacgccagtggcaagctgctcgactccatcgggtggtttcgtgacagc
ctgaactttctggcggagtacagccagtctcagggatacggttaccgttttgcgctggaa
cccaagcccaacgagccgcgcggcgacatcttctttcccaccgccggcagcatgctgggc
tttatcgccaccctcgaccagagtgaactgttcggcgtcaaccccgaattcgcgcacgac
accatggccggactcaatttcacgcacgccgtcgcacagatcatcgacgctgggaagctc
ttccacgtggacctcaacgaccagaagatgggccgcttcgatcaggatctgcgctttggc
gccgagaacatcaagagtgcctttttcctggtgaagctgctcgaagacagcggttacgac
ggtccgcgtcacttcgacgcgcacgccctgcgcaccgaggacgaggtcggtgtgtgggcg
ttcgcccggggctgcatgcgtacctacctgatcctcaaggacaaggcgcggcagtttgat
gaagaccccgaaattcaggcagccctgcaggcctaccgggtcgaggacaaggaactgagc
gagctgacacgcggcttcacgcccgaaaaagcccggaccctcaaggagcgcgcatttgat
cgcgtggccctcggtcagcgtggcccgggcctagagcagctcgatcagctcacggtcgag
ctgctgctcggggttcgtggaaacagtgtgagcagtgaggcgcacgcatga

DBGET integrated database retrieval system