KEGG   Deinococcus peraridilitoris: Deipe_1290Help
Entry
Deipe_1290        CDS       T02381                                 

Definition
Carbohydrate binding domain (family 17/28)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
dpd  Deinococcus peraridilitoris
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Deipe_1290
Enzymes [BR:dpd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Deipe_1290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1314693..1315964
Genome map
AA seq 423 aa AA seqDB search
MFSKNVSGLTAFSGAAYTRRKFKEKRLSTTAVVSGEYVRARIKGVPYRPIDRTAYAELAW
SFENDTQGFGVNSDSPDKTVTVTHDRGALKLSSLGASNDVSTGGFWSNLRISADGSSVKP
NILGAKSISMDVFVPAPTTVSIAAVPQSSNNGWTSPARAVVLTADQFTLQPDQRYKATLI
LTDADAPNLQKIAEDETNNVLSNIIFFVGTASTASNDTVWLDNITFHGHRVAAPVIHDPL
GTATLPSSFENGTRQGWDWDGESGVKSALRVQQANGSNALSWEVIYPDVKPAGGWASAPR
LVLNKSDLTRGVNSHLTFDLYLQPERASAGALQVNLAFGPPSLGYWAQASETVQLDLTTL
GSLPRTPDGLYHVKATFDLTKINDAKVLAPDTQLGKITLVVADINSNYAGKMYLDNVRFS
GAP
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgttcagcaaaaacgtttcaggattgacagcgttttcaggtgctgcttatactcgtcgc
aagttcaaagaaaaacgactctcgaccacggcagtcgtttccggcgagtacgtccgcgcc
cgcatcaagggagtcccctaccggccaatcgaccgcactgcctacgccgaactggcctgg
agcttcgagaacgacacccagggctttggcgtcaacagcgacagccccgacaaaaccgtg
acggtcacgcacgatcgtggcgccctgaaactctccagcctgggggccagcaatgatgtc
tcgacaggcggcttctggagcaacctgcgcatttccgccgacggcagcagcgtcaaaccc
aacatcctgggcgccaagtcgatcagcatggatgtcttcgttcctgcccccaccaccgtc
tccattgccgcagttccgcagagctcgaacaacggctggaccagcccggcgcgggcagtt
gtcctcacggcggatcagttcaccctgcagcctgatcagcgttacaaggccaccctgatc
ctcacggacgccgacgccccgaatctacaaaagatcgccgaagacgaaaccaacaacgtc
ctgtcgaacatcatcttctttgtcggcaccgccagcacggccagcaacgacaccgtgtgg
ctggacaacatcaccttccacggccaccgtgtcgcggcgcccgtgattcatgatccactg
ggcacagccaccctgccttcttcgttcgaaaacggcacccgacaaggctgggactgggac
ggagagtccggcgtgaaaagcgccctgagagtacagcaggccaatggctcgaacgccctg
tcctgggaagtcatctacccggacgtgaaacccgcgggtggctgggcgtcggccccgcgg
ctggtcctgaataaatccgacctcacgcgcggtgtgaattcacacctgacctttgatctg
tacctccagccggaacgcgcgagtgccggggccctgcaggtgaacctggcgttcgggccg
cccagcctgggctactgggcccaagccagtgaaaccgtccaactcgacctgaccaccctg
ggtagcctgcccagaacgccggacgggctctaccacgtcaaggcgaccttcgatctgacc
aagatcaacgacgccaaagtgctggccccggatacccagcttggcaagatcaccctggtc
gtggcggacatcaacagcaactacgccggaaagatgtacctcgacaacgtccgcttctcc
ggtgcgccctga

DBGET integrated database retrieval system