KEGG   Deinococcus peraridilitoris: Deipe_1327Help
Entry
Deipe_1327        CDS       T02381                                 

Definition
(GenBank) transcriptional regulator/sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
dpd  Deinococcus peraridilitoris
Pathway
dpd00010  Glycolysis / Gluconeogenesis
dpd00052  Galactose metabolism
dpd00500  Starch and sucrose metabolism
dpd00520  Amino sugar and nucleotide sugar metabolism
dpd00521  Streptomycin biosynthesis
dpd01100  Metabolic pathways
dpd01110  Biosynthesis of secondary metabolites
dpd01120  Microbial metabolism in diverse environments
dpd01130  Biosynthesis of antibiotics
dpd01200  Carbon metabolism
Module
dpd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dpd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deipe_1327
   00052 Galactose metabolism
    Deipe_1327
   00500 Starch and sucrose metabolism
    Deipe_1327
   00520 Amino sugar and nucleotide sugar metabolism
    Deipe_1327
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Deipe_1327
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Deipe_1327
Enzymes [BR:dpd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Deipe_1327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Glucokinase
Motif
Other DBs
NCBI-ProteinID: AFZ66876
UniProt: K9ZZ54
Position
1354277..1355179
Genome map
AA seq 300 aa AA seqDB search
MTHPIHPITTLGVDVGGTKIAYGVLRGETLLTKRSVPTPREGWHSVLDAIARVVEELRAE
FPDEAAVGIGVPGPLNHDNTEVKFAPNIYGFQNVPLVAYLSEKLGQKVVLENDAKAAALA
EDTLGAAREASSSVYITISTGIGSGIVLNGKVWRGFNGVAGEIGHIVALPGGPVAGSNVA
GALEAVASGTAMARDATFAFGTPMTTAEVFDLAQLGDTKAEKIVQGALRYIGMAIADVQK
FLDPEMFVLGGGVSEVGPYLLESVQRYADEYVSGFAQVQIRKALLGTDAGVIGAALAARS
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgactcatccgatccatcccatcaccaccctcggcgtcgacgtcggcggcaccaaaatc
gcttacggcgtgctgcgcggcgaaaccctgctgaccaaacgctcggtgcctaccccgcgt
gaaggctggcacagcgtgctggacgccatcgcccgtgtcgtcgaggaactgcgcgccgag
tttcccgatgaggccgccgtggggatcggcgtgcccggtcccctcaatcacgacaacacc
gaagtgaagttcgcgcccaacatctacggctttcagaacgtgccgctggtcgcctacctg
agcgagaagctcggtcagaaggtcgtgctggaaaacgacgccaaagccgccgcgctggcc
gaggacaccctgggagcggcgcgcgaggcgtcgagcagcgtgtacatcaccatctcgacg
ggcatcggcagcgggatcgtactgaacggcaaagtctggcgcggtttcaacggcgtggcc
ggcgagatcggtcacatcgtggcgctgccaggcggcccggtggcgggcagcaacgtggcg
ggcgcactggaagccgtggcgagcggaacggccatggctcgcgacgccacgttcgccttc
ggcactcccatgacgacggcagaggtgttcgatctggcgcaactcggggacaccaaagcc
gaaaagatcgtgcagggagcgctgcgctacatcggcatggcaatcgctgacgtgcagaaa
ttcctcgatcccgaaatgttcgtgctgggcggcggtgtctccgaggtggggccgtacttg
ctcgaaagcgtgcagcgctacgccgacgagtacgtctcgggtttcgcgcaggtgcagatt
cgcaaggcgctgctgggcacggacgccggtgtgatcggcgcggccctcgcggcgcgcagc
tga

DBGET integrated database retrieval system