KEGG   Deinococcus peraridilitoris: Deipe_1346Help
Entry
Deipe_1346        CDS       T02381                                 

Definition
(GenBank) peptidase family protein
Organism
dpd  Deinococcus peraridilitoris
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1370659..1371789
Genome map
AA seq 376 aa AA seqDB search
MPASEPAPLRPQDEPPLLAYLRHLVNLTGPSGSEEDVVRAVAQLARPLADTVEVDAPGNV
IVTRRAAQDGARRLIIATHMDEVGFRVRQVTREGFLRLEKVGGTDDRILPAQRVWIRTDS
ARLLGVIGTKSAHLLTDPDRAKVVPYPELYVDIGARDAEAASAMGVRPGDPVGFVGELTE
LGAGSGRFTGHALDDRAGCAVLLSLLERYRDNAPPVTIIAAFTVQEEVGLRGAQGVARRI
EADVALALDMTAADDTPDTGGGHLTLGAGAALKVMDFSTLAHPAVRRGLQQAADQAGLNV
QHELMRGIGTDAGALQFGGQGIPTGAVSVANRYTHSPVEVLDVQDLQGALDLLDAFAARL
PDLDLRFVDLPEAVGG
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcttcagaacccgctccgcttcgtccacaagacgagcccccgctgctcgcgtac
ctgcgtcacctggtgaacctcacgggtcccagcggcagtgaagaagacgtggtccgcgcc
gtcgcgcagctcgcgcggcccctggccgacacggtcgaagtcgacgcccccgggaacgtc
atcgtgacccgccgcgccgcgcaggacggcgcgcgtcgtctgatcatcgcaacgcacatg
gacgaggtgggtttccgggtgcgtcaggtcacccgtgagggattcttgcgtctcgagaaa
gtcgggggcaccgacgaccgcatcctgcccgcccagcgcgtgtggatccgcacggacagc
gcgcgcctgctgggcgtgatcggcaccaagagcgcgcacctgctcacggacccggaccgg
gccaaggtcgtgccgtaccccgaactgtacgtggacatcggcgcgcgggatgccgaggcg
gcgagtgccatgggcgtgcgtccgggtgacccggtggggttcgtgggtgagctgaccgaa
ctgggcgcgggaagtggccgcttcaccgggcacgccctggacgaccgggccggctgcgcg
gtgctgctctcgctgctggagcgctaccgggacaacgcgccgcccgtcaccatcatcgcc
gcctttaccgtgcaagaagaagtcggtttacgcggcgcccagggcgtcgctcgccgcatc
gaggccgacgtggccctggcgctcgacatgaccgccgccgacgacacacccgacacgggc
ggcggccatttgacgctcggtgcgggcgccgccctgaaagtcatggatttctccacgctc
gcgcatccggcggtgcgccgcggtcttcagcaggcagccgaccaggcaggattgaacgtg
cagcacgaactgatgcgcggcatcggcaccgacgccggggcgctgcagttcggcggtcaa
ggcatcccgacaggcgccgtttcggtggccaaccggtacacgcacagcccggtcgaggtg
ctcgacgtgcaggacctgcagggcgcgctggacctgctcgacgcgttcgccgcacgactt
cccgacctcgacctgcgttttgtggacctccccgaagcagtgggaggctga

DBGET integrated database retrieval system