KEGG   Deinococcus peraridilitoris: Deipe_1378Help
Entry
Deipe_1378        CDS       T02381                                 

Definition
CheY-like receiver domain/methylesterase domain-containing chemotaxis response regulator
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
dpd  Deinococcus peraridilitoris
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:dpd02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:dpd02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1403643..1404704
Genome map
AA seq 353 aa AA seqDB search
MTRLPLVVIGTSAGGVAALKHLVSQLPPDFPAALGIVLHISADAPSLLPEILSRCGPLPA
QQPQGRERLQAGRIYLAPPDHHLHVDGDHVEATKGPTENRHRPAVDVLFRSAAYTRGSDV
IGVILTGLLSDGTSGFWAIRQRGGITVVQDPQDAEYDSMPRSALSHVDVQHVVPLQELAA
LLVSLVTQDRREEEVQAMDEQELRRLQVETKVARDERAYQRGVLDLGQASFISCPECHGT
MVELREGSIIRFRCHTGHAFNSDSLLSALSKNSETQAYQLLRSLEETEVLLRRLARHSQE
LGDERRAQVLLGPIDELEAWGQGARDLALSNRRLSETGLLQGENDATVTKNGD
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtctcccacttgtcgtcatcggcacgtccgcaggcggagtggccgccctgaag
cacctcgtgagtcagctgccgccggacttccccgctgccctcggcatcgtgctccacatt
tcagcggacgcgccgtcccttcttcccgagattctcagccgctgcgggccgctgcccgcc
cagcagcctcagggccgcgaacgccttcaggccggccgcatctacctcgcgccacccgac
catcacctgcacgtggacggcgatcacgtagaagcgaccaaaggccccacggagaaccgc
caccggcctgctgtggacgtgctgttccgctccgctgcgtacacgcggggaagcgacgtg
atcggcgtcattctcaccgggctgctgagcgacggcacgtccggcttctgggccatccgt
caacgcgggggcatcacggtggtacaagacccccaggacgccgagtacgactccatgccc
cgaagcgccttgtcacatgtggacgtgcaacacgtcgtgccgctgcaggaactcgcggcg
ctgctggtgagcctcgtcacgcaggaccggcgggaagaggaagtgcaagcgatggatgaa
caggaactgcggcgcctgcaggtagagaccaaggtggcgcgggatgaacgcgcgtaccag
cggggtgtcctcgacctcggacaggcgtcgttcatctcgtgtccggagtgccacgggacg
atggtggagctgcgtgaaggcagcattatccgctttcgctgccacaccgggcacgcgttc
aactccgacagcctgctgagcgctttgtcgaagaacagcgagacgcaggcgtatcagttg
ttgcgctcgctggaagagaccgaggtgttgttgcgccgcctcgcgcggcactcccaggaa
ctgggggacgagcgccgcgcgcaggtgctcctcggtccgattgacgagttggaagcatgg
ggccaaggcgcgcgtgacttggcgctgagcaaccgtcgcttgagcgaaacgggcctcctg
caaggtgagaacgacgcaacggtgacaaagaatggggattga

DBGET integrated database retrieval system