KEGG   Deinococcus peraridilitoris: Deipe_1788Help
Entry
Deipe_1788        CDS       T02381                                 

Definition
beta-glucosidase-like glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
dpd  Deinococcus peraridilitoris
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dpd00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:dpd00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1783583..1785094
Genome map
AA seq 503 aa AA seqDB search
MIPACQNAGALLMVDLPGPVLDDDTREHLRRHAIRAVCLFRKNIENFAQLAQLTAELRLV
MGPDALIAIDQEGGGVVRTTFFPFPPSAMSLGACGDPALAFEVGAATARGLASLGINWNF
APVLDVNSNPANPVIGDRAFGSDPQQVTPLALAWLSGSLSQGVAGCVKHFPGHGDTHLDS
HLALPRVDKTRGQLENCEFMPFQRAVSEADVPAVMTAHIVYPALDETRPATLSERVLSGL
LREAWNYGGVIITDSMGMKAIDDHFGRGEAAVMALAAGADMVMALGRRSAQEETLQTVER
ALAEGRIEQSDTRRSRLRALARRFPSEKRAYDGVQREQDARIMQAAWARGLTTYRDPQFP
PPGASVTLVTLAEVPGEYVSEAGLSGAQLLRHLETLYDVRAHLVSGEVPVDWDALREERR
PVILATTTRQRFPGWRRARPDLHLALWNPYAVLDVDAPALLSYGSRPEAVQAVLGYLRGE
VAAGGRLPVLLETRSAEHPAQKP
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
gtgattcccgcttgccagaacgccggagccctcctgatggtcgaccttcctggcccagtc
cttgatgacgacacccgcgagcacctgcgccgtcacgctattcgcgcagtgtgcctgttt
cgcaagaacattgaaaacttcgcgcagctcgcgcagctcaccgccgagctgcgcctcgtg
atgggcccggacgcgctgattgccatcgaccaggaaggcggcggggtcgtgcggaccacc
ttctttcccttcccccccagtgccatgagcctgggcgcgtgcggtgacccggcactggcc
tttgaggtcggcgcagcgaccgctcgcggactggcgtcgctgggcatcaactggaatttc
gcgccggtgctggacgtcaacagcaatccggccaacccggtgatcggcgaccgggcgttc
ggaagtgatccgcagcaggtcacgccgctcgcgctggcgtggctctccgggtcactctcg
caaggggtggcaggctgcgtcaagcactttcccggccacggcgacacccacctcgacagc
cacctggcgttgccccgggtcgacaagacgcgcgggcagctggaaaactgcgagttcatg
ccgtttcagcgcgccgtttcggaagctgacgtgcccgccgtcatgaccgcgcacatcgtc
tacccggcactggacgaaacacggcccgccaccctgtcagaacgcgtgctgagcggcctg
ctgcgtgaagcctggaattacggcggggtgatcatcaccgactcgatgggcatgaaggcc
atcgacgaccatttcggtcggggagaagcggcggtcatggcccttgcagcgggcgcggac
atggtgatggctctgggacggcgcagcgcgcaggaagaaaccttgcagaccgtggagcgc
gcccttgccgaaggccgcatcgagcagtccgacacacgccgcagccggctgcgcgcgctc
gcccgccgctttcccagcgagaagcgagcttacgatggcgttcagcgggagcaggacgcg
cggatcatgcaggctgcctgggcccgggggctcacgacgtaccgcgacccgcagttccca
cccccgggcgcgagcgtcaccctggtgacgctcgccgaggtccccggcgaatacgtcagc
gaggcgggcctgagtggggcacagctgcttcgtcacctggagaccctgtacgacgtacgg
gcgcacctggtgagcggtgaggtgcccgtggactgggacgcgctgcgagaagagcgccgc
cccgtcatcctggccaccaccacccgccagcgttttcccggttggcggcgagcccgcccc
gacctgcaccttgcgctgtggaacccgtacgcggtgctggatgtggacgctccggcgctg
ctcagttacggaagccggccggaggccgtacaggcggtgctgggctatctgcgcggcgag
gtggccgcaggtggccgcctgcccgtactgctcgaaacccggtccgccgagcacccggcg
caaaagccatga

DBGET integrated database retrieval system