KEGG   Deinococcus peraridilitoris: Deipe_1877Help
Entry
Deipe_1877        CDS       T02381                                 

Definition
sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
dpd  Deinococcus peraridilitoris
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dpd00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Deipe_1877
Enzymes [BR:dpd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Deipe_1877
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1866152..1867060
Genome map
AA seq 302 aa AA seqDB search
MILTAGSANLDFVVRVPHIAAPGETVLGSDTVLMPGGKGANQAVAAARAGGKVAFLGALG
NDAFADMLLGSLSDSAVDTRHVRRVAAPTGAAYISVAENGENAITVAPGANNYLRPGDLP
ELHEATHLLLQLEIPLETVSAYASAARAAGVQVVLNAAPACALDTALLACVDILIVNEGE
LRALQGAVCTDGDLEELTAAVLARGPGTVVVTLGARGCFARSGQKTHRIPAYPVKVIDTT
GAGDTFVGVMSTWLAQGAALPEALQAASAGAALTCTRAGAQPSMPGRQEILRLLADHNAG
QR
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgattctgactgccggttcggccaatctcgacttcgtggtgcgtgttccgcacatcgcg
gcgcccggcgaaacggtattgggaagcgacacggtcctcatgccgggcggcaagggcgcc
aaccaggccgtcgccgccgcgcgcgcgggtggcaaggtggcttttctgggcgcgctgggc
aatgacgcttttgccgacatgctgctgggctcgctttccgacagtgccgtggacacccgt
cacgtccggcgtgtcgctgctcccacgggcgcggcgtatatcagcgtcgcggaaaacggc
gagaacgccatcaccgtcgcgccgggcgccaacaattacctgcgccccggcgacctgcca
gagctacacgaggccacccatctgctgctgcaactcgaaattccactggaaacggtcagc
gcctacgcgagcgccgcccgcgcggcaggcgttcaggtcgttctgaacgccgcccccgcc
tgtgcactggacaccgcgctgctggcatgcgtggatattctgatcgtcaatgaaggcgaa
ttgcgggcgctacaaggcgctgtttgcaccgacggcgacctcgaagagctgacggccgcc
gtgctcgcgcggggacccggcaccgtggtcgtcacgctgggtgcacggggctgctttgcc
cgctccggacagaaaacacaccgcattccggcctatcccgtcaaggtgatcgacacgacc
ggtgcgggtgatacttttgtcggggtcatgagcacctggctcgcccagggcgcggcgctg
cccgaagcgcttcaggctgccagcgcgggcgcggcgctgacatgcacacgcgcgggtgcc
cagcccagcatgccgggtcgacaggagatcctgcgcctgctggcggaccacaacgccggg
caacgctga

DBGET integrated database retrieval system