KEGG   Deinococcus peraridilitoris: Deipe_2129Help
Entry
Deipe_2129        CDS       T02381                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
dpd  Deinococcus peraridilitoris
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:dpd01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dpd00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dpd00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dpd00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dpd00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:dpd00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2108490..2109380
Genome map
AA seq 296 aa AA seqDB search
MTPQARPVLGLDIGGSHVTAALVDPGAREVRRDSRTVLHVAHDSPASLLTDGWARVALLA
CANEVGRVAGVGVAMPSPFEYARGVARHRHKFAALYGVNVRESLRDAWAGTPLADTSPVF
GNDADLFALGEAWAGAARGRTRVLGVTLGTGLGSGFVVAGRVVTSGEGVPPEGELWNTPY
AGALAEDSVSTRALVDAYTRSGGPQLNPADLAARARQGDVGARQVWQQFGEHLAAVLTPV
VQDFKPDVVVVGGNLTQAWTLFSAPLKLLGVPCEASRLLDEAALLGAAALVLDQHG
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgacgccgcaggcgcggccagttctcgggctcgatattggcggaagtcacgtgacggcg
gcactcgtggacccgggggcccgtgaagtgcggcgggacagccgcaccgttttgcacgtc
gctcacgactcgcctgccagcctgctcacggacggctgggcccgagtggccctgctggcc
tgcgcgaacgaggtgggccgcgtggcgggcgtcggcgtcgccatgccgagtccgtttgag
tatgcgcgcggcgtcgcccggcaccgacacaagttcgcggcgctctacggcgtgaacgtc
cgcgagtcactgagagacgcctgggcaggcactccgctggccgacacctcgcccgtcttc
ggaaacgacgccgatctgttcgcgctcggcgaagcctgggcgggcgctgctcgcggccgg
acgcgggtgctgggcgtcacgctcggcacgggcctcggcagcggttttgtcgttgcgggc
cgggtcgtcacctccggcgaaggcgtgcctccggagggcgagttgtggaatacgccctac
gcaggcgccctggccgaagattcggtttccacgcgtgcgctcgtggacgcttacacgcgg
agcggcggaccacagctcaacccggccgatctggcggcccgggcgcgccagggagacgtc
ggcgcccggcaggtctggcagcaattcggtgagcaccttgccgccgtcctgacacccgtc
gtgcaggacttcaagccggacgtcgtggtcgtcgggggaaacctgacgcaggcctggact
ctgttcagcgctcccctgaagctgctgggcgtgccctgcgaagcgtcccggctgctcgac
gaggcggccctgctgggcgcggcggccctcgttctcgatcagcacggttga

DBGET integrated database retrieval system