KEGG   Deinococcus peraridilitoris: Deipe_2315Help
Entry
Deipe_2315        CDS       T02381                                 

Definition
Mg-chelatase subunit ChlI
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
dpd  Deinococcus peraridilitoris
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dpd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Deipe_2315
Enzymes [BR:dpd01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Deipe_2315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2308447..2310306
Genome map
AA seq 619 aa AA seqDB search
MSFPFSAIVGQDDLKLALLLLAVNPAVGGVLVRGDKGSAKSTTARALAELMPGGEERAPF
VTLPLGATEDRVIGTLDLERALKGEKALQRGLIAQAHGGVLYIDEVNLLPDHLVDVLLDV
AAMGVNRVQREGLSAEHAAVFSLVGTMNPEEGNLRPQFLDRFGLCVEVATPDDPRERAEI
VRRRVRYEADPHAYAAGWQAEQDALRRALHDARVRLPGVELPDGLLETISALCRSFGVRS
LRADLVLHRATRALAALEGRETVTLEDVKRAAPLVLAHRGRQNPLQPGGGQDGQDLDELL
DGLQPPPPRDVPGEPGELGEPQDPEPQDNGPEDGALPTETDTHPEATFTASSRGVARIEL
RGAPGEQSGRSSLSQGAPRGRTVRERKNEQPGSLAVSTTLLSAADRAARAGTPLSVTRDD
LYERVREERTGVRVLFVVDASGSMGARARMEAVKGAALGLLADAYARRDEVGVIAFRGVR
AELLLPFTRDTDTAQRALQQLPTGGRTPLAHALTLAGEVLHSRQDGALLVVLTDGRGNVP
LPGGGDAWAQTLSAAAALAGTPALVLDTETGVVRAGRAAELARALGAECLTPEALSAETL
TLALRARTPSAAAQYRGTP
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
gtgagcttcccgttcagcgccatcgtggggcaggacgacctgaagctggcgctgctgctg
ctggcggtcaatccggcggtgggaggggtgctggtgcgcggggacaagggcagcgccaag
agcaccaccgcccgcgcgctcgccgagctgatgccgggcggggaagagcgagcgcccttc
gtcacgctgcccctcggcgcaaccgaggaccgcgtgatcggcaccctcgatctggagcgc
gccctgaaaggcgagaaggcgctgcagcgcggcctgatcgcgcaggcgcacggtggtgtg
ctgtacatcgacgaggtgaacctgctgcccgatcatctggtggacgtgctgctcgacgtg
gccgccatgggcgtcaaccgcgtgcagcgtgaaggcctgagcgccgagcacgcggcggtc
ttttccctggtggggaccatgaatcccgaggagggcaacttgcgtccgcagttcctcgac
cgtttcgggttgtgcgtggaggtcgctacgcccgacgacccccgcgagcgcgcggaaatc
gtgcggcggcgggtgcgctacgaagcggacccgcacgcctacgcggcgggctggcaggcg
gaacaggacgccctgcgccgggccctgcatgacgcgcgcgttcggctgccgggcgtggag
ctgcccgacgggctgctggaaaccatcagcgccctgtgccggtcgttcggcgtgcgcagc
ctgcgggccgacctcgtgctgcaccgcgccacgcgggccctggccgccctggagggccgc
gaaacggtgacgctggaggacgtgaagcgcgccgcgcccctggtgctcgcgcaccgtggg
cgccagaacccactgcagcccgggggcgggcaggacgggcaggacctcgacgagctgctg
gacgggctgcagccgcccccaccccgggacgtgccaggcgaacccggcgaactgggtgaa
cctcaggaccccgagccccaggacaacggtcccgaggacggcgcgcttcccacggaaact
gatacccacccggaagccaccttcacggcgtcatcccggggggtcgcgcgcatcgagctg
cgcggcgcgccgggtgaacagagcggacgctcctcgctcagccagggcgcgccgcgcggg
cgcaccgtgcgtgagcggaaaaacgaacagcccggcagcctggccgtgagcaccaccctg
ctgagcgccgccgaccgtgcggcccgtgcgggcaccccgctcagcgtcacccgcgacgac
ctttacgagcgggtgcgagaggagcgcaccggcgtgcgggtgctgttcgtcgtggacgcc
agcggcagcatgggcgcgcgcgcgcgcatggaggccgtgaagggcgcggccctgggcctg
ctggccgatgcctacgcgcgccgcgacgaggtgggtgtgatcgcctttcggggtgtccgc
gccgagctgctgctgcccttcacgcgtgacaccgacaccgcgcagcgggccctgcagcag
ctgccgaccggcgggcgcacgccgctcgcgcacgccctcacgctggcgggcgaggtgctg
cattcccggcaggacggcgccctgctggtcgtgctgaccgatggtcggggcaacgtgccg
ctgccgggcggcggggacgcctgggcgcagaccctgagcgccgccgccgccctggcgggc
acacccgccctggtgctggataccgaaacaggcgtcgtgcgtgccgggcgcgccgccgaa
ctcgcgcgggccctgggggccgagtgcctgacgcccgaggcgctgtccgccgagaccctc
acgctggccctgcgcgcgaggaccccatcggcagccgctcagtaccggggcacgccatga

DBGET integrated database retrieval system