KEGG   Deinococcus peraridilitoris: Deipe_2349Help
Entry
Deipe_2349        CDS       T02381                                 

Definition
(GenBank) peptidase family protein
Organism
dpd  Deinococcus peraridilitoris
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2339809..2340855
Genome map
AA seq 348 aa AA seqDB search
MTQLNLDLLRRLSEIDGVPGREEHARDLVRTEIEGLVDELREDALGNLIALKRGTAPEGE
RLRVMLSAHLDEIGFMVKFIDDQGYLRLQNLGGFDTRNLFARNVKVWTNGGELPGILTPG
GRPVHIASAEDRKKVPELREFFVDLGLGAEEVRRRVRVGDSVTLDQAFREVGDLATGKAM
DDRASVFVQIEALRALQDTPPRHDVYAVFSTQEEVGLRGAVVAAYSVEPDLGVALDVTLA
VDTPGVGPDEAVSKAGEGVGIKLFDGSMISTRFLVDEMIALAEANGIPYQLEVLPLGGTD
AGAIQRSRGGVPSVTLSLPTRYIHTVVESVHKKDLQATLDLLVAYLKH
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
gtgacacaactcaatttggatctgctgcgtcggctttcggaaatcgacggtgtgcctggc
cgtgaagagcatgcccgtgacctcgtgcgcaccgaaatcgagggcctggtcgatgagctg
cgcgaggacgccctgggaaacctgatcgccctgaagcgtggaacggcgcccgagggtgaa
cgcctgcgcgtgatgctctcggcacacctcgacgaaatcggtttcatggtgaagttcatc
gacgatcaaggctacctgcgcctgcagaatttgggtggcttcgatacccgtaacctcttt
gcgcgcaacgtcaaggtctggacgaacgggggagagctgccgggcattctcactccgggc
gggcgcccggtgcacatcgcgtcggcagaggaccgcaagaaagtgcccgaactgcgcgaa
ttcttcgtggacctcggtctgggcgcagaggaagtcaggcggcgcgtgcgggtgggagac
agtgtcacgctcgatcaggcatttcgtgaggtcggcgacctggcgaccggtaaggcgatg
gacgaccgcgccagcgtgttcgtgcagatcgaggcactgcgcgcgctgcaggacacgccg
ccgcgccatgacgtgtatgcggtgttttccacccaggaggaagtcggcctgcgcggtgcg
gtggtcgcggcgtacagtgtcgagcccgacctgggtgtggctctcgacgtgaccctggcc
gtcgacacccccggcgtggggcctgacgaggccgtttcgaaggccggagagggtgtgggc
atcaagctcttcgacggcagcatgatctccacgcgcttcctggtcgacgagatgatcgcc
ctggccgaagccaacggcattccctaccagctggaggttctgccgttgggcggcaccgat
gcgggcgccattcagcgttcgcgtggtggagtgccaagcgtgaccctcagcctgcccacg
cgttacattcacaccgtggtggaaagtgtccacaaaaaggacctgcaggccaccctggac
ctgctcgtcgcttatctcaaacactga

DBGET integrated database retrieval system