KEGG   Deinococcus peraridilitoris: Deipe_2528Help
Entry
Deipe_2528        CDS       T02381                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dpd  Deinococcus peraridilitoris
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpd00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Deipe_2528
Enzymes [BR:dpd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Deipe_2528
Exosome [BR:dpd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Deipe_2528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2531744..2533261
Genome map
AA seq 505 aa AA seqDB search
MMKYILALDQGTTSSRAIVFDQDGSIVSAAQKEFRQIFPQSGLVEHDAQEIWSNQLGVAQ
EAITRAGLRATDIAAIGITNQRETVVIWERKSGRPIHNAIVWQDRRTALLCDQLRAQGLE
ALFVQKTGLLIDAYFSGTKARWLLDHVPGAREQAERGELALGTIDSWLVYNLTGGECHIT
DASNASRTLLFNIHTGEWDDELLRILEIPRSLLPEVRPSSEVYGETSPGLLGARIPIAGM
AGDQQAATFGQACVEKGMAKNTYGTGCFMLLNTGGQAVPSQHKLLTTVAWTIRGRTDYAL
EGSIFVAGAVMQWLRDGLGIIRDSAEVEALAASVPDNGGVYLVPAFVGLGAPHWDSYARG
SIHGLSRGSTRAHIARAALESVAYQTADVLQAMQQDAATPVRELRVDGGASRNDLLMQFQ
ADVLGVPVVRPQVTETTALGAAYLAGLAVGYWESEQQIARQWREERRFEPRMGEDEREAL
LSQWRRAVQRSTAWERPDDQGATTQ
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagtacattctcgccctcgaccagggcaccaccagcagccgcgcgattgtcttc
gatcaggacggcagcatcgtcagcgcggcccagaaggagttccgccagatctttccgcaa
agcggcctggtcgaacacgacgcccaggaaatctggagcaaccagcttggcgtcgcccag
gaagccatcacccgcgcggggctgcgggccacggacatcgcggccatcggcatcaccaac
cagcgggagaccgtggtgatctgggagcgcaaaagcggcagaccgattcacaacgccatc
gtctggcaggaccgccgcaccgccctcctgtgcgaccaactgcgcgctcagggtctcgag
gcgctcttcgtgcagaagaccggcctcctgatcgacgcctacttcagcggcaccaaagcc
cgctggctgctcgatcacgtccccggcgcgcgcgagcaggccgagcggggtgaactggcc
ctcggcaccatcgactcgtggctggtgtacaacctcacgggcggcgagtgccatatcacc
gatgccagcaacgcctcacgcacgctgctcttcaatatccataccggcgagtgggacgac
gagctcttgcgcattctcgagattccgcgctcgctgctgcccgaggtgcgccccagcagc
gaggtgtacggcgaaacctcgccgggtctgctgggcgcgcgcattcccatcgcgggcatg
gcgggcgaccagcaggccgccaccttcgggcaggcctgtgtcgagaagggcatggccaag
aacacctacggcaccggctgcttcatgctgctcaatactggaggccaggcggtgccctcg
cagcacaagctgctcaccacggtggcctggaccatcagggggcgcaccgactacgccctg
gagggcagcatcttcgtggccggagccgtcatgcagtggctgcgtgacggcctggggatc
atccgggacagcgccgaggtcgaggcactcgcggccagcgtgcccgacaacggcggcgtg
tacctggtgcccgcctttgtgggactcggcgcgccgcactgggacagctacgcgcgcggc
agcatccacggtctctcgcgaggcagcacccgcgcccacatcgcccgcgccgccctggaa
agcgtcgcctaccagaccgccgacgtgctgcaggccatgcagcaggacgccgccacgccc
gtgcgcgaactgcgcgtggacgggggcgccagcagaaacgacctgctgatgcagtttcag
gccgacgtgctcggcgtgcccgtcgtgcggccccaggtgaccgagacgaccgcgctgggc
gccgcgtaccttgcgggcctcgcggtcgggtactgggaaagcgaacagcagatcgcccgg
caatggcgcgaggaacgccgcttcgaaccccgcatgggggaagacgagcgtgaagcgctg
ctctcgcagtggcggcgcgccgtgcagcgctccacggcctgggagcgccccgacgaccag
ggagccaccacacagtaa

DBGET integrated database retrieval system