KEGG   Deinococcus peraridilitoris: Deipe_2597Help
Entry
Deipe_2597        CDS       T02381                                 

Definition
(GenBank) enoyl-CoA hydratase/carnithine racemase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
dpd  Deinococcus peraridilitoris
Pathway
dpd00071  Fatty acid degradation
dpd00280  Valine, leucine and isoleucine degradation
dpd00281  Geraniol degradation
dpd00310  Lysine degradation
dpd00360  Phenylalanine metabolism
dpd00362  Benzoate degradation
dpd00380  Tryptophan metabolism
dpd00410  beta-Alanine metabolism
dpd00627  Aminobenzoate degradation
dpd00640  Propanoate metabolism
dpd00650  Butanoate metabolism
dpd00903  Limonene and pinene degradation
dpd00930  Caprolactam degradation
dpd01100  Metabolic pathways
dpd01110  Biosynthesis of secondary metabolites
dpd01120  Microbial metabolism in diverse environments
dpd01130  Biosynthesis of antibiotics
dpd01212  Fatty acid metabolism
Module
dpd_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:dpd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Deipe_2597
   00650 Butanoate metabolism
    Deipe_2597
  Lipid metabolism
   00071 Fatty acid degradation
    Deipe_2597
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Deipe_2597
   00310 Lysine degradation
    Deipe_2597
   00360 Phenylalanine metabolism
    Deipe_2597
   00380 Tryptophan metabolism
    Deipe_2597
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Deipe_2597
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Deipe_2597
   00281 Geraniol degradation
    Deipe_2597
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Deipe_2597
   00627 Aminobenzoate degradation
    Deipe_2597
   00930 Caprolactam degradation
    Deipe_2597
Enzymes [BR:dpd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Deipe_2597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFZ68062
UniProt: L0A4F9
Position
complement(2601231..2601980)
Genome map
AA seq 249 aa AA seqDB search
MTYTSLQVTHEAGVAELTLVSKRGALGPVFWQELPAALSEIKEARAVLLRSGEDFSVGLD
LVQTAPLLSASRERPEGFFELLSPMQEAIEALANVPVPVVTAVNGWCIGAGLELILACDV
RVCSHEARFSLPEVKLGIVSDLGGLGRLPHLVGEGWARRLALTGEAIGARRAERIGLVSE
VLESPDATTQHARALTHTLSELPATTLRGIKRAMNARLEAGIQVHYRETASWNALFLDAS
RVALSLKKS
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgacgtacacgagcctgcaggtcacccacgaggctggcgtggccgagctgacgctggtc
agcaagcgcggcgcgctgggaccggtcttctggcaggagctgcccgcggccctgagcgaa
atcaaagaagcccgggcggtgctgctgcgctctggcgaagacttcagcgtgggcctcgac
ctggtgcagaccgcgcccctgctaagcgcttcacgcgagcgccccgagggcttttttgaa
cttctgtcccccatgcaggaggccatcgaagcgctcgcgaacgttccggtgccggtggtg
accgccgtcaacggctggtgcatcggagcgggcctggaactgattctggcgtgcgacgtg
cgggtatgctcgcacgaagcgcggttctcgctgcccgaggtcaagctcggcattgtcagc
gacctgggcgggctgggacgtctgccgcatctggtcggcgaaggctgggcgcgccgcctc
gcgctgaccggcgaggccatcggtgcacggcgcgccgagagaatcgggctggtcagcgag
gtgctggaaagcccggacgccaccacacagcacgcccgcgcgcttacgcacaccctgagc
gaactgccggccacgaccctgcggggcatcaagcgcgccatgaacgcgcgcctggaggcc
ggaattcaggtgcactaccgcgaaacggccagctggaacgcgctgttcctcgatgcctca
cgtgtggcgctctccctcaagaaaagctga

DBGET integrated database retrieval system