KEGG   Deinococcus peraridilitoris: Deipe_2692Help
Entry
Deipe_2692        CDS       T02381                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
dpd  Deinococcus peraridilitoris
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dpd00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Deipe_2692
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Deipe_2692
Enzymes [BR:dpd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Deipe_2692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2696302..2697750)
Genome map
AA seq 482 aa AA seqDB search
MKLSHLAAALHLPSPPHDPEVEGVTHVAQWVKPGDVFVAIQGARHDGHNFIAQVVERGAV
AVAGEGYARPCAVPYLQVPSARAALADLAAELSQHPSRTLRTVGVTGTDGKTTTSWLTLH
LLRTAGLQTGLLSTVGYQLPDGLLRHFPAHFTTPEAPQVQATLREIVEAGGQAAVVEASS
HALALERLRAVEWEVGVWTHLSSEHLDFHGTVEAYFAEKRKLIERARFAVLNADDPWTER
LKLGDHTTYGVDSEATWRAHGIEEIAAGLRFRVTSPLGDFGVELPMIGRFNVQNALGAMA
AATHLGADAAQLQAGLASFGGVPGRMQIVSGGPRRVIVDFAHTPPSLEKALLALRQTTAG
RLIVVIGSAGGARDPSKRAPLGAVATTLADQAIFTEEDHRDTPLEEILTEMARGARAAGR
QNFELVPDRRDAIQRALSQARAGDTVLLAGKGPEDTLERGHVLLPWNEVEEARAALAGGA
HV
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
gtgaagctctcccacctcgccgctgccctccacctcccctccccaccccacgaccccgaa
gtcgagggcgtcacccacgtcgcgcagtgggtcaagccgggcgacgtgtttgtggcgatt
cagggcgcgcggcatgacgggcataacttcatcgcccaggtggtggagcgtggcgcggtc
gcggtggcgggcgagggctacgctaggccctgcgccgtgccgtacctgcaggtgccaagc
gcgcgggctgcgctggccgacctggcggcggagctgtcgcagcatcccagccggacgctc
cgcacggtcggtgtgaccggcaccgacggcaagaccacgaccagctggttgacgctgcat
ctgctccggacggcagggctgcagacgggcttgctgtccaccgtgggctaccagctgccc
gatgggcttttgcggcactttccggcgcacttcacaacgccggaagcgcctcaggtacag
gcgacgctgcgcgagatcgttgaggccggcggtcaggcggcggtggtagaggcgagcagt
cacgcgctggccctggagcgtttgcgggcagtggagtgggaggtgggcgtgtggacgcac
ttgtcgagcgagcacctggatttccatggcacggtcgaggcgtactttgccgagaaacgc
aaattgatcgagcgggcacggtttgcggtgctcaatgccgatgacccgtggaccgagcgg
ttgaagctgggcgatcacacgacctacggggtggacagcgaggccacctggcgggcgcat
ggcatcgaggaaatcgcggctgggctgcggtttcgcgtgacgtctcccctgggtgacttt
ggggtggagctgcccatgatcggacgcttcaacgttcagaacgccctcggggcgatggcg
gcagcgacacatctgggagcggacgcagcacagctccaggcgggcctggcgtcgttcggc
ggagtaccgggccgcatgcagatcgtttccggggggccacgccgggtcatcgtggacttc
gcgcacaccccgcccagcctggagaaggcgctgctggctttgcgccagacgacggcgggc
cgcctgatcgtggtgatcggctcggcgggtggagcgcgtgatccttccaagcgcgcccca
ttgggcgccgtggccacgaccttggccgatcaggcgatcttcacggaagaggatcaccgg
gacacgccgctggaggaaatcctgactgaaatggcgcgtggcgcgcgcgctgcaggcagg
cagaacttcgagctggtacctgaccggcgcgacgcgattcagcgggcgctgtctcaggcg
cgtgcgggtgatacggtgttgctggccggtaaaggaccggaagacaccctggagcgtggc
catgtgctgctgccctggaacgaagttgaagaggcccgggcagccctggcgggaggtgcg
catgtttga

DBGET integrated database retrieval system