KEGG   Deinococcus peraridilitoris: Deipe_2854Help
Entry
Deipe_2854        CDS       T02381                                 

Definition
succinate dehydrogenase, hydrophobic anchor subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
dpd  Deinococcus peraridilitoris
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:dpd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Deipe_2854
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Deipe_2854
   00650 Butanoate metabolism
    Deipe_2854
  Energy metabolism
   00190 Oxidative phosphorylation
    Deipe_2854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2869002..2869403
Genome map
AA seq 133 aa AA seqDB search
MTRAKTFQDAKNQAHTNAELNWWIFMRVSGLILVFLVLGHIYMTFLQVSEADATFDAVVY
KLSQPVWKLYDWLLLSLALLHGVNGARYSIEDYVRNRPNRFWVKTIFYTVVAIIFVIGSI
GLFTISPEFAGPQ
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgacacgcgccaaaaccttccaggatgccaagaaccaggcgcacaccaacgccgagctg
aactggtggatcttcatgcgggtcagtggcctgatcctggtgttcctggtgctgggtcac
atctacatgaccttcctgcaggtcagcgaggccgacgcgaccttcgacgcggtggtgtac
aagctttcgcaaccggtctggaagctctatgactggctgctgctgagcctggcgctgttg
cacggcgtcaacggtgcgcgctactcgatcgaggattacgtgcgcaaccggcccaaccgc
ttttgggtcaagaccatcttctacacggtcgtggcgatcatcttcgtgatcggttcgatc
ggcctgttcaccatctcgcccgagttcgcgggacctcagtaa

DBGET integrated database retrieval system