KEGG   Deinococcus peraridilitoris: Deipe_2854Help
Entry
Deipe_2854        CDS       T02381                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
dpd  Deinococcus peraridilitoris
Pathway
dpd00020  Citrate cycle (TCA cycle)
dpd00190  Oxidative phosphorylation
dpd00650  Butanoate metabolism
dpd01100  Metabolic pathways
dpd01110  Biosynthesis of secondary metabolites
dpd01120  Microbial metabolism in diverse environments
dpd01130  Biosynthesis of antibiotics
dpd01200  Carbon metabolism
Module
dpd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dpd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dpd_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:dpd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Deipe_2854
   00650 Butanoate metabolism
    Deipe_2854
  Energy metabolism
   00190 Oxidative phosphorylation
    Deipe_2854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS VirB8 DUF4870
Motif
Other DBs
NCBI-ProteinID: AFZ68317
UniProt: L0A561
Position
2869002..2869403
Genome map
AA seq 133 aa AA seqDB search
MTRAKTFQDAKNQAHTNAELNWWIFMRVSGLILVFLVLGHIYMTFLQVSEADATFDAVVY
KLSQPVWKLYDWLLLSLALLHGVNGARYSIEDYVRNRPNRFWVKTIFYTVVAIIFVIGSI
GLFTISPEFAGPQ
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgacacgcgccaaaaccttccaggatgccaagaaccaggcgcacaccaacgccgagctg
aactggtggatcttcatgcgggtcagtggcctgatcctggtgttcctggtgctgggtcac
atctacatgaccttcctgcaggtcagcgaggccgacgcgaccttcgacgcggtggtgtac
aagctttcgcaaccggtctggaagctctatgactggctgctgctgagcctggcgctgttg
cacggcgtcaacggtgcgcgctactcgatcgaggattacgtgcgcaaccggcccaaccgc
ttttgggtcaagaccatcttctacacggtcgtggcgatcatcttcgtgatcggttcgatc
ggcctgttcaccatctcgcccgagttcgcgggacctcagtaa

DBGET integrated database retrieval system