KEGG   Deinococcus peraridilitoris: Deipe_2913Help
Entry
Deipe_2913        CDS       T02381                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
dpd  Deinococcus peraridilitoris
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dpd00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2937470..2937976
Genome map
AA seq 168 aa AA seqDB search
MPSDIARQTALVALGANLGDPLATLSWAKEQLQQVGEVIAASRVYRTAPVGGPDGQPDYL
NAAVSLRTALSPADLLRALLNLEQAAGRERRERWGPRVLDLDLLAVNGMVLRTPELTLPH
PRLMERAFVLAPLAEIAPSWSHPLLGTSVRVALGRLDASGVKPLTSVW
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
gtgccctcagacattgcccggcagaccgcgctcgtggcgctgggtgccaacctgggcgac
ccgctggccacgctgtcgtgggccaaagagcagctgcagcaggtgggagaggtgatcgcc
gcctctcgcgtgtaccgcaccgcgcccgtcggtggcccggacgggcagccggattacctg
aacgccgccgtgagtttgcgcacggcgctgtcccccgccgacctgctgcgggccctgctg
aacttggagcaggccgccgggagagagcgccgtgagcgctggggaccacgggtcctcgac
ctcgatttgctcgcggtgaatggtatggtgctgcggacgccggaactgacgctgccccac
ccccgcctgatggagcgggcctttgtgctggcgccgctggccgaaattgcgcccagctgg
agccacccgctgctgggaacgtccgtgcgggttgcgctgggtcgcctcgacgccagcggg
gtaaagcctctgaccagtgtctggtaa

DBGET integrated database retrieval system