KEGG   Deinococcus peraridilitoris: Deipe_3175Help
Entry
Deipe_3175        CDS       T02381                                 

Definition
CheY-like receiver domain/methylesterase domain-containing chemotaxis response regulator
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
dpd  Deinococcus peraridilitoris
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:dpd00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Deipe_3175
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Deipe_3175
Enzymes [BR:dpd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Deipe_3175
Two-component system [BR:dpd02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Deipe_3175
Bacterial motility proteins [BR:dpd02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Deipe_3175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3175705..3176763
Genome map
AA seq 352 aa AA seqDB search
MQTERLVVIGGSAGALDALRAIVRDLPRDFPAAVLVVVHISPDFPSRLAQILNDSGPLEA
CHARDGDPLRAGVIHVAPPDHHLLVQRGHLRLTRSPKENRARPSIDVLFRSAAYTHGAGV
MGVLLSGMLDDGTSGLWTIKQLGGQVIVQHPEEAPQPSMPLSALRQVEVDEVLGAGQIGP
HLSEWAFAAGPLEEHVTLDDEQRRRLEVELGVATEDNAFELGVLQLGPLSPFTCPECHGV
MVQIKEGNSSRFRCHTGHAFSPSSLLAEVRDSVEASLWSAARALDENVMLLEHLARHFGE
AGEEGPREAFTHEALHAREQARLVRQSALHAKDQSDGRLLQFALESEQGQAR
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcagacagagcgcctcgtggtgatcggtgggtccgccggagcgctcgacgcgctgcgc
gccatcgttcgtgacctgccccgcgattttcccgcagcggtgctggtcgtggtgcacatt
tcgcctgactttcccagccgactggcccaaatcctgaacgacagcggaccgctcgaagcg
tgccatgcacgggacggcgacccgctgcgcgcgggcgtgatccacgtggcgccgcccgat
catcacctgctggtgcagcgcggacacctgcgcctcacccgcagccccaaggaaaaccgc
gcgcggcccagcatcgacgtgctgttccgctcggcagcgtacacgcacggcgcgggtgtg
atgggcgtgctgctgagcggcatgctcgacgacggcacctcgggcctgtggaccatcaag
cagctcggcgggcaggtgatcgtgcagcatcccgaagaagccccgcaaccctcgatgccg
ctcagcgccctgcggcaggtggaagtcgacgaggtgctcggcgcagggcaaatcggcccc
cacctgagcgaatgggccttcgcggcgggccctctggaggaacacgtgacgctggatgac
gaacagagacgacgccttgaggtcgagctcggcgtggccaccgaagacaacgccttcgag
ctgggcgtgctgcagctcgggccgctctcgccatttacctgcccggagtgccacggtgtg
atggtgcagatcaaggaaggaaactccagccgtttccgctgtcacaccggacacgccttc
tcgccttcctcgctgctcgccgaggtgcgcgacagcgtcgaagcgtccctgtggagtgcc
gcgcgcgccctcgacgagaacgtcatgctgctcgaacacctcgcccggcacttcggtgaa
gcgggcgaggaaggaccccgagaagccttcacgcacgaagcgctgcacgcgcgcgagcag
gcccgcctggtgcggcagtcggcgctgcacgccaaagaccagagcgacggccgcctgttg
cagttcgctcttgagagcgaacagggacaggcccgctag

DBGET integrated database retrieval system