KEGG   Deinococcus peraridilitoris: Deipe_3215Help
Entry
Deipe_3215        CDS       T02381                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
dpd  Deinococcus peraridilitoris
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:dpd01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:dpd00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3222454..3223746
Genome map
AA seq 430 aa AA seqDB search
MTNPMTYDQILEKTWQGDPRWQGIQRDYTGADVVKLRGSLLIEHTLAKVGAEKLWKLLHD
EPFVNALGALTGNQAMQQVKAGLKAVYLSGWQVAADANNAGQMYPDQSLYPASSVPDVVR
RINRTLQRADQIAHLEGDTSVDYFAPIVADAEAGFGGPLNAFELMKSMIEAGAAGVHFED
QLASEKKCGHLGGKVLVPTQHFIRTLNAARLAADVLGVPTLLVARTDADAADLLTSDVDE
RDHQFIVQGERTPEGFFRVRPGIDQAIARGLAYAPYADLIWCETSTPTLEEARRFAEAIH
AEFPGKLLAYNCSPSFNWKKNLDDETIARFQRELGAMGYKFQFITLAGFHSLNLSMFELA
HGYHRRQMSAFVELQEREFAAQERGFTAVKHQREVGTGYFDAVSLAVSGGRSSTVAMKGS
TEAAQFAAAD
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaccccatgacctacgaccagattctcgagaaaacctggcagggcgatccccgc
tggcaaggcattcaacgggactacaccggtgccgacgtcgtgaagctgcgcggcagcctg
ctgattgaacacaccctcgccaaagtgggcgccgagaagctctggaaactgttgcacgat
gagcctttcgtgaacgcactcggggccctaacgggcaatcaggcgatgcagcaggtcaag
gcgggtctcaaggccgtctacctgtcaggatggcaggtcgccgctgacgccaacaatgcc
ggccagatgtaccccgaccagagcctgtacccggccagcagcgtgcccgacgtcgtgcgc
cgcatcaaccgcaccctgcagcgcgccgaccagattgcgcacctggaaggggacaccagc
gtcgactacttcgcgccgatcgtcgccgacgccgaagccggctttggtggaccgctcaat
gccttcgagctgatgaagtcgatgatcgaggccggcgcggccggtgtgcacttcgaggac
cagttggcgagcgagaagaaatgcggtcacctgggcggcaaggtgctggtgcccacccag
cacttcatccgcaccctcaacgcggcacgcctcgcggcggacgtactgggggtaccgacc
ctgctggtggcccgcaccgacgccgacgcagcagacctgctgaccagcgacgtggacgag
cgcgaccaccagttcatcgtgcagggtgaacgcacaccggagggttttttccgcgtccgg
cccggcatcgaccaggccatcgcgcgcgggctggcctacgccccctatgccgatctgatc
tggtgcgaaaccagcactccgaccctggaagaagcccgacgttttgccgaggccattcac
gccgagtttcccggaaagctgctggcctacaactgctcgccgagtttcaactggaaaaag
aatctcgacgacgagaccattgcccgattccagcgtgaactgggcgccatggggtacaag
ttccagttcatcacgctggccggttttcattcgctcaacctgtcgatgttcgaattggcg
cacggctaccatcggcgccagatgagcgccttcgtggagctgcaggagcgtgagttcgct
gctcaggaacgcggtttcacggccgtcaagcaccagcgcgaggtgggcaccggctatttt
gatgcggtcagcctggccgtttcaggcggcaggagcagcacggtggccatgaagggcagc
accgaagcggcgcagtttgccgccgccgactga

DBGET integrated database retrieval system