KEGG   Deinococcus peraridilitoris: Deipe_3463Help
Entry
Deipe_3463        CDS       T02381                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
dpd  Deinococcus peraridilitoris
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:dpd00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:dpd00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3485841..3486755
Genome map
AA seq 304 aa AA seqDB search
MRSLLDFGGWSEARVNAIFDTADVMKEVLARPVKKVPALQGLTICTAFFENSTRTRMSFE
LAARRMSADVVTFAAGASSLSKGESLRDTVETLGAMQVDAFIVRHEASGAAHLVERYSGK
PTINAGDGRRAHPTQALLDAYTLRREFGDLAGRKVAIIGDVRHSRVARSNAELLPMLGAR
VTLCGPATLLPGELARRGVTLTTDPHEAVKGADAVMALRLQHERMNAGYLGSLQEYARHY
QVNDALLLRTGEHAVVMHPGPMNRDLEISGETASGPRSRIVQQVENGLAVRMSVLYHLLV
GRGE
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaggagtttgctcgacttcggtggctggagcgaggcgcgcgtgaacgccatcttcgac
accgccgacgtgatgaaagaagtgctggcgcgcccggtcaagaaagttcccgccctgcag
ggcctgaccatctgcaccgcctttttcgagaacagcacccgcacccgcatgagtttcgaa
ctggccgcgcgccgcatgagcgcggacgtggtgacctttgcagcgggagcgagctccctc
agcaagggcgagagcttgcgtgacacggtcgagacgcttggtgccatgcaggtcgacgcc
ttcatcgtccggcacgaagcttccggagcggcccacctcgtggagcgctacagcgggaag
cccaccatcaatgccggagacgggcgacgcgctcatccgacccaggcgctgctggacgcc
tacaccctgcggcgcgaattcggagacctggcggggcggaaagtggcgatcatcggcgac
gtgcgtcattcgcgcgtcgcacgcagcaacgccgaactcctgcccatgctgggcgcgcgc
gtcactctctgcgggcctgccacactgcttcccggtgaactcgcgcggcgcggcgtgacg
ctcaccaccgatcctcacgaggccgtgaagggcgccgacgccgtgatggccctgcggctg
cagcatgaacgcatgaacgcaggctacctgggcagcctgcaggagtatgcgcggcactat
caggtcaacgacgccctgcttttgcggaccggtgaacacgccgtggtgatgcaccccggc
cccatgaaccgtgacctcgaaatcagcggtgagaccgcgtcgggaccgcgctccagaatc
gtgcaacaggtcgaaaacggcctggcggtgcgcatgagtgtgctgtaccacctgctcgtc
gggaggggcgaatga

DBGET integrated database retrieval system