KEGG   Deinococcus peraridilitoris: Deipe_3485Help
Entry
Deipe_3485        CDS       T02381                                 

Definition
RecD/TraA family helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
dpd  Deinococcus peraridilitoris
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dpd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Deipe_3485
Enzymes [BR:dpd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Deipe_3485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3504850..3506970)
Genome map
AA seq 706 aa AA seqDB search
MTPDSPLTSNPDAPSAQHLRVRGSVNKVRFRADSGFAVLSATIENEEGRDNDATLVGMVP
PLESGDTFNAEVTLEEHREYGYQYRIQLLLLDDVPVALNEEGVAAYLEARVAGVGKVLAG
RIAQHFGADALDILSEDPERLLSVPGVTRSTLHKIVQSWEEAGGERRLIAGLQGLGLSIS
QAQRAVKHFGSNALDHLNSDIYALTEIEGIGFLTADKLAEKQGIQRDDPRRLTAAAVYAL
QQAQLAGGHTYLPHERALRGLVHYARVSPLQAEFALESASELGRVIDDDGRIYLPSVLRA
EKKLASTIRTLLATPPSDEWTVTKKDARGLSAQQAEILQLLEENRLVVLTGGPGTGKSTT
TRAVADLAEKLGLEVGLCAPTGKAARRLGEVTGRTASTIHRLLGYGPDGFRFGPIEPLLY
DLIIVDEVSMCGDALLLALLSALGPGTRVLLVGDADQLPPVDAGLPLLALTQIAPTVRLQ
QIYRQAAESPIVTAAHGLLGGQPPVFGPAALRHIEVESDVGARRVALLVRELGGPSMVQV
LSPMRKGPLGVEMLNHALQSLFNPGSGGTRIGEFEVRAGDYVVQTKNDYQNEVFNGTLGL
VLAEGGGKVQVDFEGNIVELSGAELWNLQLGYALTVHRAQGSEWKTVLGVLHEAHANMLS
RNLAYTALTRASERFLAVGSERAWAIAASRQREVRHTHLLERIRGA
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
gtgaccccagattctccgctcacctcgaaccccgacgctccatccgctcagcatctgcgg
gtgcgtggcagcgtgaacaaagtgcgcttccgtgctgacagcggctttgccgtgctctcg
gcaaccatcgaaaacgaagaaggccgggacaacgacgccaccctggtcggaatggtgccc
ccgctggagtccggtgacaccttcaacgccgaggttaccctcgaagagcaccgcgaatac
gggtatcagtaccgcattcagctgctgctgctggacgacgtgcccgtggcgctcaacgaa
gagggtgtcgcggcctacctggaagcgcgcgtcgccggagtcggcaaagtgctggcagga
cgcatcgcgcagcatttcggtgccgacgccttggacattctcagtgaggaccccgaacgg
ctgctgtcggtgcccggcgtgacccgcagcaccctgcacaaaatcgtgcagagctgggaa
gaagcgggaggcgagcgtcgcctgatcgcagggctgcaaggtctgggactcagcatctcg
caggcccagcgcgccgtgaagcacttcggctcgaacgccctggatcacctcaattcggat
atttacgcgctcacggaaatcgaaggcatcggctttctcaccgccgacaagctcgccgag
aagcagggaatccaacgcgacgacccgcgacgactgacggccgcggcggtctatgccctg
cagcaggcccagctggcgggtgggcacacctacctgccgcacgaacgcgcgctcaggggg
ctcgtccactacgcgcgggtctcgccgctgcaggccgaatttgccctggaaagcgccagc
gaactcggacgggtcatcgacgatgacgggcgtatctaccttccgagcgtgctgcgcgcc
gaaaagaagctcgcgagcaccatccgcacgctgctggccacgccgcccagcgacgaatgg
accgtcacgaaaaaggacgcccgcgggctcagtgcccagcaggccgaaatcttgcagtta
ctggaagaaaaccggctggtggtgctgacgggcggaccgggcaccggcaagagcaccacc
acgcgggccgtggccgatctggccgagaagctcgggctggaagtcggcctgtgcgcgcca
accggcaaggcggcgcgccggctgggcgaagtgacgggcagaactgccagcaccattcac
cggctcctcgggtatggcccggacggttttcgcttcgggcccatcgagccactgctctac
gacctgatcatcgtggacgaggtcagcatgtgcggcgacgcgttgctgttggccctgctc
agtgcccttgggccgggcacgcgcgtactgctcgtgggggacgctgatcagctgccgccc
gtcgatgcaggcctgcccctcctcgcgctgacccagatcgcgcccaccgtgcgcctgcag
caaatttaccgtcaggcggccgaaagtccgattgtgactgccgcccacgggttgctgggt
ggtcagccgcccgtcttcgggcctgcggctttgcgccacatcgaggtcgaaagcgacgtg
ggcgcgcgccgggtggctttgctggtgcgcgaactgggcgggccgtcgatggtacaggtc
ctctcccctatgcgcaagggcccgctgggcgtggaaatgctcaaccacgccctgcagagc
ctgttcaatcccggctcgggcggcacgcgcatcggcgagttcgaagtgcgcgcaggcgac
tacgtggtgcagaccaagaacgattaccagaatgaggtgttcaatggaacgctcggcctg
gtgctcgcagaaggcggcgggaaagttcaggtggacttcgagggcaatatcgtcgaactg
tccggcgccgagctgtggaatctgcagctgggctacgcgctgaccgtacaccgcgcgcaa
ggcagcgagtggaagaccgtgctgggcgtcttgcacgaggcccacgcgaacatgctgtcg
cgcaatctggcctacacggccctgacacgggccagcgagcgtttcctggcggtcggctcc
gagcgggcctgggccattgccgcgtcgcgtcagcgcgaagtgcgtcacacgcacctgctc
gaacgtatccgtggagcgtga

DBGET integrated database retrieval system