KEGG   Deinococcus peraridilitoris: Deipe_3548Help
Entry
Deipe_3548        CDS       T02381                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
dpd  Deinococcus peraridilitoris
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Deipe_3548
Enzymes [BR:dpd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Deipe_3548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3572730..3574232
Genome map
AA seq 500 aa AA seqDB search
MTRSSGVLLHLTSLPGPYGIGEFNEHAYACVDWLARAGQQYWQVMPLGPTGYGDSPYQSF
SAFAGNPYLISLDALRRDGLLSDQDLSGHPDFDHDRVDFGVQYTWRNGVLRRAFEHFEAG
AGAGLTGDFQAFCEAEAAWLDDYALFMALKDAHGGRAWNEWDREIRTRQSAAMAAWRDKL
EREVRLYSFVQFLFFRQWNALRAYAHQQGVQIIGDIPIFVAMDSADAWANPDQFYFDAEG
QPSVVAGVPPDYFSATGQLWGNPLYRWDVMQQQGFRWWIERIQGSLKLYDVIRIDHFRGF
AAYWEIPYPAENAMNGQWVPAPGHALFEAVRGALGELPIIAEDLGVVTPDVEALRDDFGL
PGMAVLQFAFGGNDWEKNAFLPENLRLNQVVYPGTHDNDTSLGWWHKAQEHERRHVMQYL
PDASDLNFGWRLTELAWSTRCVLAVAQLQDLLNLGSEARINLPGSLGAHNWTWRARPEAF
SSELARDLRALTERHDRLPR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgacgcggtccagtggcgttctgctgcacctgacttcgctgcccggaccgtacggcata
ggagaattcaatgagcacgcatatgcctgcgtcgactggcttgctcgggccggacagcag
tactggcaggtgatgccgcttggcccgaccggctacggcgacagcccctatcagtcattc
agtgcgtttgccggcaatccatacctgatttcactggacgccctgcggcgcgacggcctg
ctgagcgatcaggatctgtccggtcatccagacttcgaccacgaccgtgttgatttcggc
gtgcagtacacgtggcgcaatggggtgttgcgccgcgccttcgagcacttcgaggcgggc
gctggcgcggggttgacgggcgacttccaggccttttgcgaagccgaggccgcctggctc
gacgattacgcgttgttcatggccctcaaggatgcgcatggtggacgggcctggaatgaa
tgggaccgcgagatccgcacccggcaaagtgcggcaatggccgcgtggcgcgacaagctg
gagcgcgaggtgcggctgtacagctttgtgcagtttctgtttttccgtcagtggaacgca
ctgcgcgcttacgcccaccagcagggcgtgcagatcatcggcgacattccgatttttgtg
gcgatggattcggcggacgcgtgggccaaccccgaccagttttatttcgacgccgaaggt
cagccgtcggtggtggcgggcgtgccacccgactacttctcggcaaccggtcagctgtgg
ggcaacccgctttaccgctgggacgtcatgcagcagcaaggattccgctggtggatcgag
cgcattcagggcagcctgaagctctacgacgtgatccgcatcgaccatttccgtggcttt
gcggcgtactgggaaattccctatcccgccgaaaacgccatgaacggccagtgggttccc
gcacccggacacgcgctgttcgaggcggtgcgcggcgcgctcggcgagttgcccatcatc
gccgaggatctgggggtggtgaccccggacgtggaagcgttgcgcgacgacttcgggttg
ccgggcatggccgtgctgcagttcgcctttggcggcaatgactgggagaagaacgcattt
ttgcctgaaaatttgcgtctcaaccaggtggtctatccgggtacgcacgacaacgatacg
tcgcttggctggtggcacaaggcgcaggagcacgaacgccggcacgtaatgcagtatctg
ccggacgccagtgatctgaatttcggctggcgcctcaccgagctcgcctggtcgacacgt
tgcgtgctggccgttgcgcagctgcaggacctgctgaacctgggcagcgaggcgcgcatc
aacctgcccggcagtctgggcgcccacaactggacctggcgcgctcgtccggaagcgttc
agctccgaacttgcccgtgatttgcgcgcgctgaccgagcgtcatgaccggttgccccgc
tga

DBGET integrated database retrieval system